Sequence alignment for CL0484

PF08372

Q8S1F8_ORYSJ/928-1080--------------------------------------------VPTASLYVFLIGVWY.--------------.YRFRP
Q403P3_CRYJA/36-191--------------------------------------------LPTIFLYMFLIGIWH.--------------.FRFRP
Q5TKJ0_ORYSJ/649-804--------------------------------------------LPTIFLYMFMIGLWN.--------------.YRYKP
Q9FJG3_ARATH/893-1049--------------------------------------------VPTLAFYLFVIGAWN.--------------.YRFRS
Q8H2Q5_ORYSJ/856-1011--------------------------------------------LPTIFLYMFLIGLWN.--------------.YRFRP
A5C8U1_VITVI/865-1020--------------------------------------------LPTVFLYMFMIGLWN.--------------.YRGRP
A2XK62_ORYSI/899-1054--------------------------------------------LPTVCLYLFLVLLWR.--------------.YRARP
Q0D8E3_ORYSJ/881-1037--------------------------------------------VPTLTLHVAAVGVWK.--------------.YRRRP
Q765H8_FLATR/281-435--------------------------------------------LSSIFLTLFSIGVWN.--------------.YRWRP
Q9M2D4_ARATH/816-972--------------------------------------------LPVMSLCLFMLGVWN.--------------.YRLRP
Q60EW9_ORYSJ/619-774--------------------------------------------LPTIFLYLFLIGVWY.--------------.YRWRP
Q9T0C8_ARATH/702-857--------------------------------------------LPTMFLYMFLIGLWN.--------------.YRFRP
Q7XKA3_ORYSJ/864-1021--------------------------------------------LPTVFLYLFVIGVWN.--------------.YRRRP
Q9LZE5_ARATH/588-744--------------------------------------------LSGLHKFL.TRKFWN.--------------.KRENP
Q69T22_ORYSJ/477-632--------------------------------------------LPTVFLYMFMIGLWN.--------------.YRRRP
Q9FI32_ARATH/881-1036--------------------------------------------LPTMFLYMFFIGLWN.--------------.FRSRP
O49435_ARATH/618-774--------------------------------------------VFSMLLYCFVFGLYR.--------------.FGLRP
Q9M366_ARATH/632-795--------------------------------------------LREILKSPRQTYNW.L--------------FYRNVT
Q9SS68_ARATH/861-1017--------------------------------------------LPTVFMYAFLILALR.--------------.FRYRG
A2XB01_ORYSI/845-999--------------------------------------------LPTAFLAMAFTGLWR.--------------.YRVRS
O80558_ARATH/628-783--------------------------------------------LPTVFLYLFVIGMWN.--------------.YRYRP
Q01IK6_ORYSA/659-814--------------------------------------------LPTAFLYASVAGAWS.--------------.YRRRP
Q6EUH5_ORYSJ/624-779--------------------------------------------LPTFFLYKFMLGMRN.--------------.YLRRP
A5BPW2_VITVI/822-977--------------------------------------------LPTVFMYAFFIIVLR.--------------.FRYRR
O65279_ARATH/520-675--------------------------------------------LPTVFLYMAVIGMWN.--------------.YRFKP
Q2HRE0_MEDTR/921-1076--------------------------------------------LPTMFLYMFIIGLWK.--------------.WRFRP
Q43085_PEA/213-368--------------------------------------------MPTMFLYVFVIGMWN.--------------.WRFRP
Q93ZA2_ARATH/514-669--------------------------------------------LPTTFLYMFLIGLWN.--------------.FRFRP
O64492_ARATH/857-1012--------------------------------------------LPCLLLYTAAVGVWR.--------------.FRRRS

PF06398

Q758I9_ASHGO/63-412PGLSVPIMSRNFVQMNSRLSFPFQVV...NEVIRIANWESTACTLSVGMLYSFVVLRPLV..............TLSSAP
Q4WG87_ASPFU/114-487H.RKSPLLVATPPAITRALAYSHPFILPLNKLAGLLTWTTDDPWQSFLLVAGFWTVVLYS..............DAIILW
A3GFP1_PICST/23-380T...NTNLLVESPILASALSNIFPYLLLLDNVLEVITWTNDDPYQNFLFIVIYSWLVMYW..............HSISYI
Q6BWT4_DEBHA/130-546PNLSIRILTSNFKRLSSKMSSFFVLQ...YGLIHIITWRKPTKTLSFLVFYTSICLWPHL..............ILA.YP
Q6BIC3_DEBHA/22-384TSSSHTQLLTEYPILSSALSNIFPYLLLIDNFLEIVTWTNEDPYQNFILIVLYSVIIMYW..............QILSFI
A3GHG6_PICST/131-541PNLSIRILLSNFKKLAGKMGMFFELQ...YGIIHIITWRKPTKTLTALVLYTTICLWPHL..............VVT.YP
Q0UCD7_PHANO/96-443PNFSIPTMSSNFRRFNSRIGVAFILQ...NRLIHLFTWAEPTQTLSFLFVWTFLCVDPYL..............LPV.LP
Q6BPA3_DEBHA/104-486PPLSVNLISKNSILLNSRLSVPFETI...DGVIKFFNWDNSSFTVGILLVITHIILNPYL..............ILV.LP
A5DFV2_PICGU/131-552PGLSISVIAGNFKALSGRMTGFFTVQ...YGLIHIITWRHPSKTLTFLVFYTATCLWPHL..............VLA.YP
Q0V1J3_PHANO/49-353H.QKSPLLAATPPQITRVLAYSHPFILPLNKLVGLLTWTTGDPWESFLLVASFWAIVMYG..............DAVTRY
A5DFP0_PICGU/28-381P.QASPLLSSTPPTVAKSLVKSYPYLLIVNKALSIFTWTNDDYWVNLIIVCMYSLLVVYF..............ENIITW
Q6BYT2_DEBHA/63-426P.QTSPLLSSTPPSVAKSLVRSYPYLLIVNKFLSIITWTNDDYWINIILVCLYSLAILYF..............ENLVTW
A4GFC7_PICAN/70-420P.QSSPLLSSTPPTVSKSLIKAYPYLIALNKILGVLTWTDDTSYISVLLVTTATLFILYF..............ENFVIY
A7A1K7_YEAS7/58-403V.ATSPLLTSTPPTISKALVKLYPYLILIDEFLNVVTWTGKNIWSSVLMLCLFITTVEYF..............ETLVKY
Q9UV60_YARLL/25-364Q.SMSPLLSSTPPTVTKALAQAYPYILASDKVLGLLTWTEDDQWQSFLLVAVYVTVVMYY..............EYLVIY
Q6CSS7_KLULA/54-399V.ESSPLLNSTPPTVSKALVKLYPYLVVCNEFLGLLTWTSDDIWKSVLMVICYIAVILYF..............QVVVRY
Q59WI8_CANAL/24-381P...TSRLLTESPKLSTALSQIFPYLLLIDNLLEILTWTNEDHYQNFLLLTCYSCIIVYW..............NWVSHV
A3LMZ2_PICST/28-391P.QTSPLLSSTPPTVAKALIKAYPYLLIINKMLSVATWTNDDSWINIVIVAVYSLVILYF..............ESLIIW
Q6CXM3_KLULA/59-410PGLSVPIMSRNFVQMNSRLGAPFMII...DEIIRIFNWTNAAYTLCIMSFYSFLVLKPLP..............VLVSGP
A1CDA3_ASPCL/48-420H.RKSPLLVATPPAITRALAYSHPFILPLNKLAGLLTWTTGDPWQSFLLVAGFWTIVLYS..............DAIILW
A7E6F1_SCLS1/107-489PAFNITTMSNNFRRFNARIGVVFVFQ...AKVIRLLSWKQWSHTLSFLAVYTFVCLDPYL..............LTV.LP
A7TDR4_VANPO/106-455PRLSVPVMSRNFILSNARFGLPFTMV...DEVIYIFSWLNPAYTLSILIIYSFIILKPLP..............SLLSIP
A7TKV5_VANPO/49-397I.VSSPLLSSTPSTISKSLVKIYPYLILADSFLGLVTWTNENIWGSILITLAYIMGILYF..............QNITKY
Q6CN25_KLULA/177-532QTVSVTIMNKNVRALTSRLGAIFELQ...DILIRLLTWRNPSGTLLALIAFTQICFNPML..............LVI.LP
Q6FJ63_CANGA/118-468PSLSVPITSRNFILMNSRLSVPFLVI...DEIIKILNWVDPAYTLSMALIYTLIVLRPLQ..............VLSSLP
A6ZZ68_YEAS7/115-465PKLSVQITSRNFIQMNSRLGVPFMIM...DELIKILNWTNPAYTVSIMFLYTLIILKPFQ..............MLSSLP
Q752S3_ASHGO/50-392V.VSSPLLNSTPPTVTKSLVKLYPYLVIADRALSTLTWTNDDVWESVLMVICYGAGVVYF..............ERLIKF
Q7S6Z9_NEUCR/280-710H.QKSPLLLATPPQITRALAYSHPFLLPLNTLAGLITWTTRDPWESFLMVAVFWAAVLYG..............DIIVRV
PEX32_YEAST/26-408Q..KPSLIQITPPMISSTLFHAYPLLLIFDNALANIMWLSDDKCLTFIYLTSIWLTISFFIPVETEASHFLPFTKILRLW
A6ZUZ6_YEAS7/50-394I.LSSPLLTSTPKTVSRSLVRLYPYLIVVDNFLSIITWSNDNVSANLLGIFLFTVCVLYF..............GFITRY
Q6FJI4_CANGA/13-429Q..KPSLTLVTPVMLSMSLAKIYPLLIIADAALDNLMWICEDPNLPFLYVVLTYLSLSLYSWSWEYPVAGSQMANIILLW
A4GFD2_PICAN/121-493PQLSLNVMSKNAIQLLSRLSVPFVLI...DQVIIIFSWSKPLYTLTFLNVATLLILKPIL...............LLSLP
A4GFN5_PENCH/56-430H.RKSPLLVATPPAITRALAYSHPFLLPLNKLAGLLTWTSGDPWQSFLLVATFWTIVLYS..............DAIILW
A2R1B9_ASPNC/54-425H.RKSPLLVATPPQITRALAYSHPFILPLNKLVGLLTWTTGDGWQSFLLVAGFWTLVLYG..............DVIVTW
A2QGY9_ASPNC/84-515PAFSLPLMANNFRRFNARIGIVFLFQ...TRVERLLSWKQTSHTVSFLFVYSFICLDPHL..............LVI.IP
Q75AQ6_ASHGO/185-541HPISLIIMSRNLKIMTTKLGLIFEFQ...DSLVRLATWRNPSGTALSLILFSFACFNPML..............VII.LP
Q2UTA0_ASPOR/52-419H.RKSPLLVATPPPITRALAYSHPFILPLNKLVGLLTWTTDDAWQSFLLVSIFWTIVLYG..............DAIILW
A7TEV3_VANPO/152-511QPISASTLGRNMGKLGSKMTAMFDMQ...ETVIRLITWRNPSGTVTLLISMTMLFYNPII..............LLL.LP
A5DUM8_LODEL/24-379P...TSKLLVESPTLASSLSQIFPFLLLIDNFLETITWTNDDHYRNFLIMTLYTCVVMYW..............NIVSQF
Q7S7I8_NEUCR/80-508PGFTVGAMSNNFRRFNARIGVVFKFQ...AKALRVLSWRRPTHTLSLLAVYTFVCLDPYL..............IFV.LP
PEX32_SCHPO/1-480M.IRAHLFSEPD...NSKLWAKSTGSDAFDLILKVLLWTAPWYYCLTTLFFTWLIILYPR..............PTLACS
Q8NJX0_YARLL/178-534PELSIPLLLRNIAELSKRAGGVMKTQ...TVVLKAIQWQNPCLSISCIFIYTAMCLYPGI..............VFV.LP
A4GFD3_PICAN/18-342T.KVKGQLLNMPPVITSALYAAFPVIFLLDKVLAFLTWTNDDPYTNFIAIAIYIMVVKYW..............TVVACT
Q0CPT8_ASPTN/42-419H.RKSPLLVSTPPPVTRALAYSHPFILPLNKLVGLLTWSTGDAWQSFLLLASFWTLVLYG..............DVIILW
Q6FXX0_CANGA/58-376V.MPSPLLSSTPPSVVRSMVRLYPYLKLTDKALGVLTWSDFSIWNSIVLVPAYLLFVLYY..............EVFVAY
Q5ACV4_CANAL/52-403P.QSSPLLSSTPPSVSKALVNSYPYLIIINKLLSITTWTNDDYWVNVVIISLYALVVLYF..............ENLVIW
PEX28_YEAST/201-569PVFSATTLGSNFKKLSKKMGSIFELQ...DSIVRLLTWRNPTGTVTSLILFTLICFNPMY..............LVI.LP
A5DUZ7_LODEL/104-459P.QSSPLLSSTPPLVSKALVNAYPYLLIVNKILSIATWTNEDYWVNVVLLALYALFVLYF..............EQVVTW
A7EH28_SCLS1/61-453H.QKSPLLLATPPQITRALAYSHPFLLPLNKLAGLITWTSGDPWESFLLVASFWAFVLYG..............DVVMRY
Q5ANG0_CANAL/154-573PGLSFGILTSNVKQMASKMTNFFALQ...YEVLYIIAWKKPTKTISALVLYTAVCLWPHL..............VLA.YP
Q6FR12_CANGA/140-535PPFSASVLASNMKKLSGKMDSIFEFQ...DNMIRVLTWKTPTVTLTALTIFTLICFDLMN..............VIL.FP
A5DZV8_LODEL/165-601PGLSFPILISNLKQLGSKMTNLFALQ...YEIINIVAWRKPNKTLSVLVLYTAACMWPHL..............ILV.YP
Q2GTD2_CHAGB/75-535H.QKSPLLLATPPQITRALAYSHPFLLPLNRLVGLITWTTNDPWESFLLLAGFWAAVLYG..............DFVVRV
Q6FTU9_CANGA/51-394I.VSSPLLNSTPPTVSKALVKLYPYLIVTDKFLSIVTWTNDNLWLNFLSVLSYFVFVLYF..............QFLVKY

PF08372

Q8S1F8_ORYSJ/928-1080RGPA.GMDARLSQADT..VEADDLEEE-----------------------------------------------------
Q403P3_CRYJA/36-191RXPP.HMDTRISHADA..VHQDELDEE-----------------------------------------------------
Q5TKJ0_ORYSJ/649-804RHPP.YMDTKLCHAEF..TNPDELDEE-----------------------------------------------------
Q9FJG3_ARATH/893-1049RAALPHFDPRLSLADA..ADRDELDEE-----------------------------------------------------
Q8H2Q5_ORYSJ/856-1011RFPP.HMNTRISHADM..TNPDELDEE-----------------------------------------------------
A5C8U1_VITVI/865-1020RYPP.HMNTKISYADN..VHPDELDEE-----------------------------------------------------
A2XK62_ORYSI/899-1054REPT.GMDPRLSHVDS..VSPDELDEE-----------------------------------------------------
Q0D8E3_ORYSJ/881-1037RAPAPHPCVRASMAEA..ADREELDEE-----------------------------------------------------
Q765H8_FLATR/281-435RYPP.HMDTHLSCADN..THPDELDEE-----------------------------------------------------
Q9M2D4_ARATH/816-972RQPP.HMDTRLSFADN..IHPEELNEE-----------------------------------------------------
Q60EW9_ORYSJ/619-774RQPP.HMDTRLSHAES..AHPDELDEE-----------------------------------------------------
Q9T0C8_ARATH/702-857RYPP.HMNTKISQAEA..VHPDELDEE-----------------------------------------------------
Q7XKA3_ORYSJ/864-1021RKPA.HMDTALSHAEAEQVHPDELDEE-----------------------------------------------------
Q9LZE5_ARATH/588-744RSPLIVNDLKLWKLES..PNLDELEEE-----------------------------------------------------
Q69T22_ORYSJ/477-632RHPP.HMDTKMSWAEA..VHPDELDEE-----------------------------------------------------
Q9FI32_ARATH/881-1036RHPP.HMDMKLSWAEA..VGPDELDEE-----------------------------------------------------
O49435_ARATH/618-774RHPP.HMDIKLSKADS..ALPDELDEE-----------------------------------------------------
Q9M366_ARATH/632-795PPPLILVDLKLRKLDS..INLDELAEE-----------------------------------------------------
Q9SS68_ARATH/861-1017RVKVNSVDPRLSCVDS..VAPDELDEE-----------------------------------------------------
A2XB01_ORYSI/845-999RHPP.HMEMRLSHADA..ATVDELDEE-----------------------------------------------------
O80558_ARATH/628-783RHPP.HMDARVSQADN..AHPDELDEE-----------------------------------------------------
Q01IK6_ORYSA/659-814RRPP.QADAGLSCAEA..AGADEFDEE-----------------------------------------------------
Q6EUH5_ORYSJ/624-779KHPW.HVDMRVSHADT..AHPDELDEE-----------------------------------------------------
A5BPW2_VITVI/822-977RVLL.SMDTRLSYAEA..ISADELDEE-----------------------------------------------------
O65279_ARATH/520-675RFPP.HMDAKLSYADN..VNSDELDEE-----------------------------------------------------
Q2HRE0_MEDTR/921-1076RNPP.HMNTSLSCTDV..TTPDELDEE-----------------------------------------------------
Q43085_PEA/213-368RHPP.HMNPKLSYTDG..VTTDELDEE-----------------------------------------------------
Q93ZA2_ARATH/514-669RHPA.HMDTKVSWAEA..ASPDELDEE-----------------------------------------------------
O64492_ARATH/857-1012RYPP.HMDARISHAET..VFPDELDEE-----------------------------------------------------

PF06398

Q758I9_ASHGO/63-412MFYILFAVMVPYYMQI--HAPEPWEEL.....................................................
Q4WG87_ASPFU/114-487GGPILVVVGLILGMYW--RRFSPLSTAAFTGEK...............................................
A3GFP1_PICST/23-380ILPIIMSITFSALVWS--ISSVIYDSK.....................................................
Q6BWT4_DEBHA/130-546MIFLIFGVMLPAYIHR--H.PMRTPELIKVKKRGQSILDFFNSSSDTSVIEDLIGKDYHNDSGSESDSLQPVISKSSDTS
Q6BIC3_DEBHA/22-384IMPILISVTFACFVWS--ISSIIYDSK.....................................................
A3GHG6_PICST/131-541LIFLLFGIIVPGYLHR--H.PMRTPELIKVKKRGQSLFSFLNEGAGEHSIIDDLLSDS............VLGDEGLRPT
Q0UCD7_PHANO/96-443LASLLFFVMVPSFLTR--H.PEPEVHVG....................................................
Q6BPA3_DEBHA/104-486LLLILINIMVPHYLVL--H.PTDRSVLNS...................................................
A5DFV2_PICGU/131-552LLFLLFGIMIPGYIHR--H.PMQTPELIKVRKRGQSL...........................................
Q0V1J3_PHANO/49-353AGPIIVVSGLILGMYT--RRYSPLSST.....................................................
A5DFP0_PICGU/28-381SGHLVVV....AILAL--YALLNHKIT.....................................................
Q6BYT2_DEBHA/63-426SGHLIIV....GIITL--YALLNNKII.....................................................
A4GFC7_PICAN/70-420LGHLSIV....GLIFL--YSIFRSYVE.....................................................
A7A1K7_YEAS7/58-403FGHLAII....AILWG--YSLLDNYIE.....................................................
Q9UV60_YARLL/25-364CGHILAV....GFIWA--FVYIRQSVE.....................................................
Q6CSS7_KLULA/54-399FGHFLFV....GLLWG--YSALDTFVE.....................................................
Q59WI8_CANAL/24-381ILPILMTLAFSSIVWF--ISSIIYDSK.....................................................
A3LMZ2_PICST/28-391FGHIIIV....GIITM--YAFLNNKIV.....................................................
Q6CXM3_KLULA/59-410FVYILFGIMSPTYMDI--HKPDPHMNL.....................................................
A1CDA3_ASPCL/48-420AGPIFVVIGLILGMYW--RRFSPLSSAATTGEK...............................................
A7E6F1_SCLS1/107-489LAVLLLAVLIPSFIAR--H.PAPPTTITTDS.................................................
A7TDR4_VANPO/106-455IFYILFGVMVPQYLYI--HKPETLPYF.....................................................
A7TKV5_VANPO/49-397FGHVVVV....GLLWG--YSLLHQNIE.....................................................
Q6CN25_KLULA/177-532ILYLMFGLMIPGYLHR--H.PLHRGIYLSKRSYGKSLIKSITTG....................................
Q6FJ63_CANGA/118-468ILYLLFGIMVPEYLHI--HEPSENVYL.....................................................
A6ZZ68_YEAS7/115-465IFYLLFCVMVPQYLYI--HKPNPTSYL.....................................................
Q752S3_ASHGO/50-392FGHLVIV....GVLWG--YSLLDKHVE.....................................................
Q7S6Z9_NEUCR/280-710AGPVVLVLLLIGGMYG--RRYSPLSSSGWTEPGVAAGDMAALAGTDGKGSVRGKKAPKSKNLS...VDGLPDNKNGKANG
PEX32_YEAST/26-408LGIISGAFLFLSFMYY--.....IVSL.....................................................
A6ZUZ6_YEAS7/50-394FGHLMIV....GIIWV--YLLIDKHVQ.....................................................
Q6FJI4_CANGA/13-429LELSSGVFLLFAASYF--.....ISSV.....................................................
A4GFD2_PICAN/121-493FFYTCFGIIVPAYMKR--HPPDKHTIL.....................................................
A4GFN5_PENCH/56-430AGPILVVVALILGMYG--RRYSPLSSTTSTGEK...............................................
A2R1B9_ASPNC/54-425TGPLLVVISLILGMYW--RRYSPLSSRAHLSEK...............................................
A2QGY9_ASPNC/84-515FAVLLFFVMVPAFLAR--H.PPPPSTSTSSI.................................................
Q75AQ6_ASHGO/185-541MLYVLFGLMIPGYLHR--H.PLRRNFYLTKHSYGKSLLATVATG....................................
Q2UTA0_ASPOR/52-419AGPPLVVVGLILGMYW--RRYSPLSTRSISGEK...............................................
A7TEV3_VANPO/152-511LVTLMYMVMIPGYIHR--H.PLHRAIYPSRTSYGRSLLEDIASS....................................
A5DUM8_LODEL/24-379FLPIILVLIFSFFVWL--ISSVVYDSK.....................................................
Q7S7I8_NEUCR/80-508LAIALFGIFVPSFIAR--H.PAPASSSEAHAV................................................
PEX32_SCHPO/1-480VAAWLFWFTSLDTLEP--..DDRKNTLKASEAVSTSAKTSEETAKPSETREDGEWNTLK...........NTLEADAQNL
Q8NJX0_YARLL/178-534GLLFMYGIMAPAYAEK--H.PLPKEYRPSPWTVKN.............................................
A4GFD3_PICAN/18-342VLPTIIALGTCASLWF--LKTTIDDLR.....................................................
Q0CPT8_ASPTN/42-419AGPLLVVIGLILGMYW--RRYSPLSSSRTVPNENK.............................................
Q6FXX0_CANGA/58-376LGHMIVIFCVLGLMWI--YNFV..........................................................
Q5ACV4_CANAL/52-403SGHLILV....AILIS--YALLNNKII.....................................................
PEX28_YEAST/201-569IFRFVYGIVVPGYVRK--H.PLQRSIYPLKRNHGSSLLYDVCYE....................................
A5DUZ7_LODEL/104-459LGHLLIA....AAITL--YAVLNNRII.....................................................
A7EH28_SCLS1/61-453AGPLVVVIGLILGMYS--RRYSPLSSTSWTGEKQ..............................................
Q5ANG0_CANAL/154-573LLFVLFGVLIPGFVHR--H.PQRNPELIKVKKRGQSLLSFLFET....................................
Q6FR12_CANGA/140-535MAYIVLVQMTQGYIRR--H.PIRRTIYIKRRAIGRSLIHDLF......................................
A5DZV8_LODEL/165-601LLFVLFGMLLPGYTHR--H.PPRRPDLIKVKSRGQSLFKFLNAT....................................
Q2GTD2_CHAGB/75-535AGPLVLVFVLIGGMYG--RRFSPLSSSGWSEPGLGTADGAAVVAEAKGAKGSRGSKNL............SVDGLPEKNG
Q6FTU9_CANGA/51-394FGHLLII....GIIWC--YSLVDSAVE.....................................................

PF08372

Q8S1F8_ORYSJ/928-1080---------------------FDAVP....PPEVLRAR------------------------------------------
Q403P3_CRYJA/36-191---------------------FDTFP.TSKSSDVVRMR------------------------------------------
Q5TKJ0_ORYSJ/649-804---------------------FDSFP.SSRPADIVRMR------------------------------------------
Q9FJG3_ARATH/893-1049---------------------FDVVP.SNRPPEMVRLR------------------------------------------
Q8H2Q5_ORYSJ/856-1011---------------------FDTFP.TSKSPDLVRMR------------------------------------------
A5C8U1_VITVI/865-1020---------------------FDSFP.TSRGSELVRMR------------------------------------------
A2XK62_ORYSI/899-1054---------------------FDGLP.SARPADVVRMR------------------------------------------
Q0D8E3_ORYSJ/881-1037---------------------FDAIP.SSRPPEVVRAR------------------------------------------
Q765H8_FLATR/281-435---------------------FDTIP.TSHPPDIISMR------------------------------------------
Q9M2D4_ARATH/816-972---------------------FDTFPFSSQDPGIVKMR------------------------------------------
Q60EW9_ORYSJ/619-774---------------------FDTFP.TSRPPDIVRMR------------------------------------------
Q9T0C8_ARATH/702-857---------------------FDTFP.TTRNPDMVRLR------------------------------------------
Q7XKA3_ORYSJ/864-1021---------------------FDTFP.TSKPGDVVRMR------------------------------------------
Q9LZE5_ARATH/588-744---------------------FDSFPSSVSDVNILRMR------------------------------------------
Q69T22_ORYSJ/477-632---------------------FDTFP.TSRQQDVVYMR------------------------------------------
Q9FI32_ARATH/881-1036---------------------FDTFP.TSRSQELVRLR------------------------------------------
O49435_ARATH/618-774---------------------FDVFP.SSKSGDVLKRR------------------------------------------
Q9M366_ARATH/632-795---------------------FDSFPSSENDLNILRMR------------------------------------------
Q9SS68_ARATH/861-1017---------------------FDGFP.TTRQPEVVRIR------------------------------------------
A2XB01_ORYSI/845-999---------------------FDTFP.SSRG.DVVRFR------------------------------------------
O80558_ARATH/628-783---------------------FDTFP.TSRPADIVRMR------------------------------------------
Q01IK6_ORYSA/659-814---------------------ADTFP.TSRPDGVVRAR------------------------------------------
Q6EUH5_ORYSJ/624-779---------------------FDEFP.TARPPEVVRMR------------------------------------------
A5BPW2_VITVI/822-977---------------------FDSFP.TIKSXDQVRQR------------------------------------------
O65279_ARATH/520-675---------------------FDTFP.TVRAPDIVKMR------------------------------------------
Q2HRE0_MEDTR/921-1076---------------------FDTFP.TKKSQDIVRWR------------------------------------------
Q43085_PEA/213-368---------------------FDTFP.STKSPDIVRWR------------------------------------------
Q93ZA2_ARATH/514-669---------------------FDTFP.TSKGQDVVKMR------------------------------------------
O64492_ARATH/857-1012---------------------FDTFP.TSRGFDVVRMR------------------------------------------

PF06398

Q758I9_ASHGO/63-412......................GANPIPAAGPALKEPDLPR.......................................
Q4WG87_ASPFU/114-487................RQHQKSVSEGSSHQHETLD.............................................
A3GFP1_PICST/23-380...........................FDEKPTID.............................................
Q6BWT4_DEBHA/130-546SMFSKKPVSASKLKDGDVNERIQKKDKTRHVKSQM.............................................
Q6BIC3_DEBHA/22-384...........................FNEKPTID.............................................
A3GHG6_PICST/131-541FSGSEESSDVLQISPSEVISETSV.STDDSKKPIAKS...........................................
Q0UCD7_PHANO/96-443....................DADLWQGSLSGPPLANARTIK.......................................
Q6BPA3_DEBHA/104-486...................MYFQRNPVPDDGPALRESEIPK.......................................
A5DFV2_PICGU/131-552............LEFLSSSDETSIVDDIVEDRTLRSAENDLDPVSSRSSDTSSAFTQAPISASALSTSSSDVNEKVKKDE
Q0V1J3_PHANO/49-353...........................GWTGEKGQ.............................................
A5DFP0_PICGU/28-381.........................QETNSKPTLD.............................................
Q6BYT2_DEBHA/63-426.........................EETNLHPTLD.............................................
A4GFC7_PICAN/70-420.........................KEQKKSPTLD.............................................
A7A1K7_YEAS7/58-403.........................GTLSSSPTLE.............................................
Q9UV60_YARLL/25-364.........................RRQTSEPSLD.............................................
Q6CSS7_KLULA/54-399.........................TTIKEKPTLD.............................................
Q59WI8_CANAL/24-381...........................YDEKPTIE.............................................
A3LMZ2_PICST/28-391.........................EETNLHPTLD.............................................
Q6CXM3_KLULA/59-410......................DHNPIPARGPPLKNPQLPG.......................................
A1CDA3_ASPCL/48-420................RHQKKASE.TSPHQHETLD.............................................
A7E6F1_SCLS1/107-489..................FTYS......TTGPPIAPAPTVK.......................................
A7TDR4_VANPO/106-455......................DSNPTPAQGPPLRKPAVPE.......................................
A7TKV5_VANPO/49-397.........................DIMSSQPTLD.............................................
Q6CN25_KLULA/177-532....GNTSKLQLRDSIHEFNYEDIDINDLRKANT.VR...........................................
Q6FJ63_CANGA/118-468......................DTNRVPAQGPPLRKAEVPK.......................................
A6ZZ68_YEAS7/115-465......................DNNQTPAQGPPLRRPEVPK.......................................
Q752S3_ASHGO/50-392.........................ETIRDRPTLD.............................................
Q7S6Z9_NEUCR/280-710GLGGGVGASAGGGGQLRNQGSVSEVTNTRHQKTLD.............................................
PEX32_YEAST/26-408......................IASLRDTEPPTLD.............................................
A6ZUZ6_YEAS7/50-394.........................ETMASCPSLD.............................................
Q6FJI4_CANGA/13-429......................YYNISTSEPPTVD.............................................
A4GFD2_PICAN/121-493.....................QNRNPVPADGPSVSHVDVPR.......................................
A4GFN5_PENCH/56-430................HRTKVAPD.SSLRHQKSLD.............................................
A2R1B9_ASPNC/54-425...............QGHQRAASE.TFPHRHETLD.............................................
A2QGY9_ASPNC/84-515.................TPYYS......YEGPALAPAKTIK.......................................
Q75AQ6_ASHGO/185-541....GKPASWQSHDDVQEFDYNNLHTDTEEWERALHIK..........................................
Q2UTA0_ASPOR/52-419...............PGHQRAPSE.SSLRHHDSLD.............................................
A7TEV3_VANPO/152-511....GPSNAWYPNNTLVESLNELQSGDSGATSNFSDTNS.........................................
A5DUM8_LODEL/24-379...........................YEEKPTIE.............................................
Q7S7I8_NEUCR/80-508................RNLGYS......PRGPPLAPARTFK.......................................
PEX32_SCHPO/1-480MSGFQMLQRRWSQPKTTTLKTEVKEQQASQSPSVEGENEPAGVKSNEATKPSVT................EEKEKNAEQN
Q8NJX0_YARLL/178-534..............EFDMAADDDTSIRAAQIKRIKAAE..........................................
A4GFD3_PICAN/18-342..........................SETAPPTIE.............................................
Q0CPT8_ASPTN/42-419.............KTSDHQRGPSD.GSLYHHDSLD.............................................
Q6FXX0_CANGA/58-376.........................ESPQDVPILE.............................................
Q5ACV4_CANAL/52-403.........................KEANLHPTLD.............................................
PEX28_YEAST/201-569....GKNEYSYGQQFFSKSFMDTLESRNQEIDEISELDKRTEN.....................................
A5DUZ7_LODEL/104-459.........................EEASLRPTLD.............................................
A7EH28_SCLS1/61-453..............KKGHKRVESEMTNTKHQKTLD.............................................
Q5ANG0_CANAL/154-573.....PETSIVEDLINEEYLQAS...DEVASSTYSISEETSEVTVSSSMPTD....................SESPKKDD
Q6FR12_CANGA/140-535......HGGKKTNNVLLPSNENDCNGEQENEADLGTSDDCNGTSDENVVISP...................AAAKIDKNI
A5DZV8_LODEL/165-601.....EETSIVEDLVDTEYLKEDADIADVNSTSYTMSEAESDNTKASTAVSVSSQG...........GTESSEKLDKKKE
Q2GTD2_CHAGB/75-535KAANGSAGAGGASGHARNKGSISEVTNTRHQKTLD.............................................
Q6FTU9_CANGA/51-394.........................DTMMSCPSLD.............................................

PF08372

Q8S1F8_ORYSJ/928-1080-----------YERLR---------------TLAGRVQRVMGDVAAQGERVQALVS----WR..DPRASRIFVGVCLAVA
Q403P3_CRYJA/36-191-----------YDRLR---------------SVAGRLQTVVGDIATQGERFQALLS----WR..DPRATAIFVLFCLFAA
Q5TKJ0_ORYSJ/649-804-----------YDRLR---------------SVGGRVQTVVGDLATQGERAHALLS----WR..DPRATAIFIFLSLVVA
Q9FJG3_ARATH/893-1049-----------YDKLR---------------NVGARVQTILGEVAAQGEKMQALVT----WR..DPRATGIFVGLCFFVA
Q8H2Q5_ORYSJ/856-1011-----------YDRLR---------------HVAGRIQTVVGDIATQGERLQSLLS----WR..DPRATSMFLLFCLLTA
A5C8U1_VITVI/865-1020-----------YDRLR---------------SVAGRIQTVVGDVATQGERFQALLS----WR..DPRATTIFLVFCLLVA
A2XK62_ORYSI/899-1054-----------YDRLR---------------AVAGRAQTLLGDVAAQGERIEALLS----WR..DPRATAVFAVVCLLAA
Q0D8E3_ORYSJ/881-1037-----------YDRAR---------------MVGARLQAMVGDVATQAERLQALVS----WR..DPRATGVFVALCVFVA
Q765H8_FLATR/281-435-----------YDRLR---------------RESGRIQRMVGDMATVGERLQSLLR----LE..RPNR...YINVCIILF
Q9M2D4_ARATH/816-972-----------YERLR---------------SIASRAQTVVGDIAGQGERVQALLS----WR..DPRATSIFMVLCLVST
Q60EW9_ORYSJ/619-774-----------YDRLR---------------SVAGRIQTVVGDLATQGERLQSLLS----WR..DPRATALFVTFCFVAA
Q9T0C8_ARATH/702-857-----------YDRLR---------------SVAGRIQTVIGDLATQGERFQALLS----WR..DPRATAIFVILCFIAA
Q7XKA3_ORYSJ/864-1021-----------YDRLR---------------SVAGRVQTVVGDLATQGERAQALLS----WR..DPRATSIFVLLSLIIA
Q9LZE5_ARATH/588-744-----------YDRIR---------------MVCQRPMILLGDAASQGERLYALLT----FNGDDQLASFYCWLICVLVA
Q69T22_ORYSJ/477-632-----------YDRLR---------------SVAGRIQTVVGDMATQGERLQSLLG----WR..DPRATCLFVVFCLVAA
Q9FI32_ARATH/881-1036-----------YDRLR---------------SVAGRIQTVVGDIAAQGERIQSLLS----WR..DPRATSLFILFCLAAS
O49435_ARATH/618-774-----------YDRLR---------------GIAGRMMIVLGDLATQGERVKSLLS----WR..DPRATSLFLTFCFVSC
Q9M366_ARATH/632-795-----------YDRLR---------------KIMENVMLLMGDAATQGERLLAAFT----L.....LERPFVLIILLALC
Q9SS68_ARATH/861-1017-----------YDRLR---------------ALAGRAQTLLGDVAAQGERVEALFN----WR..DPRATCIFVVFCLFAS
A2XB01_ORYSI/845-999-----------YDRLR---------------SVAGRVQTVVGDIATQGERMQALLS----WR..DPRATVLFSIACVLAA
O80558_ARATH/628-783-----------YDRLR---------------SVGGRVQTVVGDLATQGERIQALLS----WR..DPRATALFIVFALIWA
Q01IK6_ORYSA/659-814-----------YDRLR---------------TVAGRIQAVVGDVATQGERVRSLLA----WR..DPRATAVFTAACLAAA
Q6EUH5_ORYSJ/624-779-----------YDKLR---------------SLNARIQEIVGDIATHAERARCVMT----WR..DPRATGLYLLGCLCLA
A5BPW2_VITVI/822-977-----------YDRLR---------------ILAGRAQTLLGDXAAQGERLEALFN----WR..DPRATGLFVVFCLVAS
O65279_ARATH/520-675-----------YDRLR---------------SVAGKVQSVAGDIAAQGERVQALLS----WR..DPRATAIFVTFCFIIA
Q2HRE0_MEDTR/921-1076-----------YDRLR---------------SLAGRVQSVVGDIATQGERLHALLN----WR..DPRATYIFMAFSFVAA
Q43085_PEA/213-368-----------YDRLR---------------SVAGRVQSVVGDLATQGERVQALVS----WR..DPRASSMFMAFCLVSA
Q93ZA2_ARATH/514-669-----------YDRLR---------------SVAGRIQMVVGDIATQGERFQALLS----WR..DPRATCLFVIFCLVAA
O64492_ARATH/857-1012-----------YDRVR---------------SIAGRVQTVVGDMASQGERVQALLS----WR..DPRATFLFLMFCLLAA

PF06398

Q758I9_ASHGO/63-412..PVPELSKEFILNLT...............DLQNHMVLYVVCYDFITGLLAKFAF....FA--DENVSAAAFVGLLVLG
Q4WG87_ASPFU/114-487.........EIVETLR...............TFTTRCNILLEPLLELTDFLSTQRTATSATT--RPALTTMFIRILFVTP
A3GFP1_PICST/23-380.........EILHTLH...............NITIRFDMLLRPMKHIP............FK--FKNYVKLLVMSALLTP
Q6BWT4_DEBHA/130-546.........TLFINMR...............DLQNLTTDVLNGINGAEKFWYETAG....FK--DERLSTFIFYGVIAAT
Q6BIC3_DEBHA/22-384.........EVLHTLH...............NITIRFEMLLRPIQHFP............MK--KRNFVKAFIMTFLLTP
A3GHG6_PICST/131-541.......QLALLINMR...............DLQNLTTDLLNGMDLAEKSWFETFG....FK--DEHLSTFIFYGVAAAT
Q0UCD7_PHANO/96-443..PAPEFSKDFFRNMR...............DLQNCMEDFSTIHDAVLAFLTPLTN....FS--NENLSSMLYILLLLLS
Q6BPA3_DEBHA/104-486..PVPEFSNEFILNLT...............DLQNHMLLYVVTYDLILWGTKEFLF....YK--DENISSVVFLGLLILG
A5DFV2_PICGU/131-552KARYVKSQMKLLMNMR...............DLQNLTTDLLQGFDAAEVFWYQTAG....FK--DERLSTFMFYGVILAT
Q0V1J3_PHANO/49-353.........KVHK....................RAESESDIKHHKSLE..............--..DIVDMSL.......
A5DFP0_PICGU/28-381.........DVVQALT...............TTCIKADMLLDPITSLA............LS--AHDIKRLLFTTVFLTP
Q6BYT2_DEBHA/63-426.........DVVQALT...............TTCIKADMLLNPITSLS............LT--AYDIKRLLFTTVFLTP
A4GFC7_PICAN/70-420.........DVVHCLT...............TVSVRADMLLVPVSSLN............LT--SADLRRLLFTSIFLSP
A7A1K7_YEAS7/58-403.........DIALLMN...............RVSLKSDILLSPMVNLG..............--TQDIQRLLYTTVILSP
Q9UV60_YARLL/25-364.........AIVHTLT...............NVTTKANLLLLPITSLS............LT--PRDVTRLAFTTLFLSP
Q6CSS7_KLULA/54-399.........DIVHIIS...............CVYTKADLLLSPLSVWT..............--GNDIKRILLTMAFLSP
Q59WI8_CANAL/24-381.........EVLYTLH...............NITIRCEMLLRPIKHVP............IQ--RKHFIKLVIASIFLTP
A3LMZ2_PICST/28-391.........DVVQALT...............ATCIKADMLLNPITSLS............LT--AYDIKRLLFTTIFLTP
Q6CXM3_KLULA/59-410..PVPEFSKEFILNLT...............DLQNHMTLYVMAYDFVSNFLAKFAY....FK--NENVSSAVFLGLLLFS
A1CDA3_ASPCL/48-420.........EIVETLR...............TFTTRCNILLDPLLELTEFMSTQRTATSATT--KPALTTLFIRILFVTP
A7E6F1_SCLS1/107-489..PVKELSKDFFRNMR...............DLQNCMEDFSQLHDKIISLISPSTN....FS--NEPLSSTLFLFLVVTA
A7TDR4_VANPO/106-455..PASELSQEFVLNLT...............DLQNHMLIYVRVYDFFAKILGSFAF....FT--DEAVSAMAFLILLSFA
A7TKV5_VANPO/49-397.........DIVLMMD...............KVTRKFDMFLSPITILS..............--AQDIRRLLSTTIFLSP
Q6CN25_KLULA/177-532......QSMEFVVNLR...............DLQNLMSTLVSVIDKMEKFMYGTAG....FK--NEQYSTVVFLSCFVVL
Q6FJ63_CANGA/118-468..PVPEFSQEFVLNLT...............DLQNHMLLYVQLYDSIIYVLQKFAF....FV--NEQISAVAFVLLMILA
A6ZZ68_YEAS7/115-465..PVPELSQEFVLNLT...............DLQNHMLLYVKFYDFTLLILQKFAF....FT--NEAISSFYFIVLLIIA
Q752S3_ASHGO/50-392.........DVVQMMS...............RVVAKSDLLLSPVSVLS..............--GNDIKRLLLTMVFLSP
Q7S6Z9_NEUCR/280-710.........EIVETLK...............EFTARCNILLEPMLELTDFLSTQRTPTSATT--KPALTTLFIRILLCTP
PEX32_YEAST/26-408.........EIVVLLE...............SVLDKLEVLRNELNVWKKLKLSFDGVNKECS--GKRLFCRLF..LFGTI
A6ZUZ6_YEAS7/50-394.........DIIHVMD...............RVSMKSSAVLSPITILS..............--AQDVRRLLFTIAFLSP
Q6FJI4_CANGA/13-429.........DIILNLE...............SLLDKLETLRNEIMFRRWFKKPI......SK--VKMLQIFVRLVLVLTP
A4GFD2_PICAN/121-493..PVPELSREFVLNFT...............DLQNHMLLYVMSYDFVTSLIVKYLY....FK--DENITIFIFVALLTSG
A4GFN5_PENCH/56-430.........EIVETLR...............IFTTRCNILLEPLLDLTDFLSTQRTPTSATT--KPALTALFIRILLVTP
A2R1B9_ASPNC/54-425.........EIVETLR...............TFTTRCNILLEPLVEFTDFLSTQRTATSATT--RPALTTLFFRILFVTP
A2QGY9_ASPNC/84-515..PASETSKDFFRNMR...............DLQNCMADYSDVHDATVSAFAPLTN....FS--NEKLSSTVFLTCTLMA
Q75AQ6_ASHGO/185-541......QTMEFIVNLR...............DLQNLMTASVKGIECAEKFVYGDAG....FK--NEHHSTVLFLSGLLVV
Q2UTA0_ASPOR/52-419.........EIVETMR...............AFTTRCNMLLEPFLELTDFLSTQRTATSATT--RPALTTLFFRILFVTP
A7TEV3_VANPO/152-511....VSHSMAVVMNLR...............DVQNITTSLVQVSQATDKFIYGAAG....FK--DERRSTILFFTCFLAT
A5DUM8_LODEL/24-379.........EVLYTLH...............NITVRSEMILRPIKKFP............FT--AKNFKRLFIVTTLLTP
Q7S7I8_NEUCR/80-508..PTKELSRDFFRNLG...............DLQNVMDDYSVAHDKIIALVVPKTN....FS--DEALSSAIFVLLCGAC
PEX32_SCHPO/1-480KRRERLSISHIVTELAKKDEVSSESGSNEIVNAKLKNEQLDSNFTLLDAYLEPLVHL.HEYS--RRSNTLFFFYLPIVMS
Q8NJX0_YARLL/178-534.....KKPVDVKKSMK...............NFQNATTNLIKALDKLESFLSGPAG....FA--NESLSALIFLLIGFAM
A4GFD3_PICAN/18-342.........EIIDTLI...............NLQARFSYIVEPFSYFGS...........LS--SSDYFNLGFSLIAITP
Q0CPT8_ASPTN/42-419.........EIVESMR...............VFTTRCNILLEPLLELTDFLSTQRTATSATT--RPALTTLFFRILFVTP
Q6FXX0_CANGA/58-376.........DIVLKMN...............RVQYKFDKFIEPVITLK..............--EQDITKLLYVSMLISP
Q5ACV4_CANAL/52-403.........DVVQALT...............STCVKADILLSPITSLS............LT--AYDIKRLIFTTLFLTP
PEX28_YEAST/201-569.TGELKQGMKVLINLR...............DMQNMTSGTLHVIEAINSFLRKSSS....FQ--NEECSTKRFFTGFLLI
A5DUZ7_LODEL/104-459.........DVVQALN...............ATCLKADMLLLPITSLS............LT--AYDIKRLLFTTVFLTP
A7EH28_SCLS1/61-453.........EIVETLK...............IFTSRCNVLLDPLLQLTDFLSTQRTATSATT--RPALTTLLIRILLVTP
Q5ANG0_CANAL/154-573VAKHRKSQIALLINLR...............DFQNLTTDILKGINNAEKFYYETGG....FK--DERLSTFIFYGVLLST
Q6FR12_CANGA/140-535STYNLNHGTKVVLTLR...............DMQNMTTGTVHLMDAIDKFKYGTAA....FV--DEYKSTSVFFTLLGSV
A5DZV8_LODEL/165-601VSKRRKRNLDLLVNLR...............DMQNSMTDLLKLIEEGETFYYETAG....FK--DERLSTFIFYGVLVAT
Q2GTD2_CHAGB/75-535.........EIVETLR...............EFTARCNILLEPLLELTDFLSTQRTPTSATT--RPALTTLFVRILLCIP
Q6FTU9_CANGA/51-394.........DIVHIMV...............RVSTKADIVLSPLTILN..............--SQDIQRLLFTSAFLSP

PF08372

Q8S1F8_ORYSJ/928-1080VALYAM----------------PS........KMVAVAGGF....YYLRHP-----------------------------
Q403P3_CRYJA/36-191IVLYVT----------------PF........QVIAVLFGI....YVLRHP-----------------------------
Q5TKJ0_ORYSJ/649-804IVLYVT----------------PF........QVLLVIAML....YLLRHP-----------------------------
Q9FJG3_ARATH/893-1049LVLYLV----------------PT........KMVAMASGF....YYFRHP-----------------------------
Q8H2Q5_ORYSJ/856-1011VILYVT----------------PF........QVIALCLGF....FWMRHP-----------------------------
A5C8U1_VITVI/865-1020LVLYIT----------------PF........QVLALVAGF....YHMRHP-----------------------------
A2XK62_ORYSI/899-1054LVMYAV----------------PF........KLLLLAMGF....YYLRHP-----------------------------
Q0D8E3_ORYSJ/881-1037MALYVV----------------PI........KVVAVVAGF....YYLRHP-----------------------------
Q765H8_FLATR/281-435NCCYCS----------------VC........HTFTMLWSFRPVIFVLTH.-----------------------------
Q9M2D4_ARATH/816-972VVLYVV----------------PF........KVFVLLAGL....YIMRPP-----------------------------
Q60EW9_ORYSJ/619-774IVLYVT----------------PF........RVVVFLAGL....YTLRHP-----------------------------
Q9T0C8_ARATH/702-857IVFFIT----------------PI........QIVVALAGF....FTMRHP-----------------------------
Q7XKA3_ORYSJ/864-1021VVLYVT----------------PF........QVVAVVVGL....YLLRHP-----------------------------
Q9LZE5_ARATH/588-744LCWYNI----------------PM........WLWSLYPIA....YWLNFT-----------------------------
Q69T22_ORYSJ/477-632VVLYVT----------------PF........RVVALVAGL....YLLRHP-----------------------------
Q9FI32_ARATH/881-1036VVLYAM----------------PF........KAIALASGL....YYLRHP-----------------------------
O49435_ARATH/618-774GVICFV----------------SM........KLLLTFLAF....YVMRHP-----------------------------
Q9M366_ARATH/632-795YCSMLV----------------VCLGWDLHVRKCLIFVFIC....YWVQLP-----------------------------
Q9SS68_ARATH/861-1017FLFYIV----------------PF........KVFLLGSGF....YYIRHP-----------------------------
A2XB01_ORYSI/845-999VIAYTI----------------PM........KVLVGLWGL....YAMRPP-----------------------------
O80558_ARATH/628-783VFIYVT----------------PF........QVIAIIIGL....FMLRHP-----------------------------
Q01IK6_ORYSA/659-814VVAYAT----------------PP........RVVALVAGL....YLLRHP-----------------------------
Q6EUH5_ORYSJ/624-779VITFSV----------------PF........QAVALLTGF....YLMRHP-----------------------------
A5BPW2_VITVI/822-977LVFYTV----------------PF........RAFVLGWGF....YYLRHP-----------------------------
O65279_ARATH/520-675MALYIT----------------PF........KLVALLSGY....YFMRHP-----------------------------
Q2HRE0_MEDTR/921-1076IVLYLI----------------PT........QLVFLSAGF....YLMRHP-----------------------------
Q43085_PEA/213-368VVLYMT----------------PF........QIPILIGGF....YFLRHP-----------------------------
Q93ZA2_ARATH/514-669MILYVT----------------PF........KIIALAGGM....FWMRHP-----------------------------
O64492_ARATH/857-1012VGFYTV----------------PV........KLTVAISGL....YYLRPP-----------------------------

PF06398

Q758I9_ASHGO/63-412VFNMLFIE....SLFRWIPL..KL--------LLLACGWGF----LIMLHPSCRDACFD.................YISS
Q4WG87_ASPFU/114-487IWIALTL.....PPFYIITT..RR--------VVMTIG.TI----ILTYHSRPARVSRVILWRSLT....VRRICSMITG
A3GFP1_PICST/23-380LHWFIV........SYIVPP..QK--------CVWFSG.VF----ILTYHSPWAFSIRRLLWRSVY....VRIAAVYLTG
Q6BWT4_DEBHA/130-546SIVLVF........GRFIPW..RL--------IFIQSGWAG----LIVCHPNSKKYIMS.................IKKS
Q6BIC3_DEBHA/22-384IHVLLV........KYVIPP..QK--------VLWLTG.LF----MLTYHSAWSFSIRRLLWRSVY....IRIFAFYVTG
A3GHG6_PICST/131-541SVVLFL........GQFIPW..RL--------IFIQSGWAG----ILLCHPKSKTFLVE.................LSNA
Q0UCD7_PHANO/96-443CTLFIS........AHLLPW..RL--------IFLAIGYTL----TALGHPTIQDLLAT.................PENE
Q6BPA3_DEBHA/104-486LHNLFVLPKVVPILFWYLPI..RF--------MLVISIWAV----AILFHPVVRNRLLN.................WMYN
A5DFV2_PICGU/131-552SIILFL........GTFIPW..RL--------IFIQSGWAI----VLVCHPRSKKYLKA.................LSEN
Q0V1J3_PHANO/49-353........................--------.........----..SWHSRPARVTRTLMWRSRM....VRKTCAFLTG
A5DFP0_PICGU/28-381LYLIVT........LVVIPP..RT--------ILLVVG.VY----LLTYHSVYMRVTRRIIWKLKI....ARLICFYLTG
Q6BYT2_DEBHA/63-426LYLIVT........FLLVKP..RI--------ILLFTG.LH----ILTYHSSYSRVARKMLWKIKL....VRVLCFYLTG
A4GFC7_PICAN/70-420GYILVC........YLLFPP..KT--------LLLILV.IF----FLTYHSSWSRVTRKLLWRSSI....VRAFCFYNTG
A7A1K7_YEAS7/58-403IYVMIT........WLLLPP..RS--------LMLMVG.MF----LLTYHSPWSKVARRLLWKFKI....VRLLVFYVTG
Q9UV60_YARLL/25-364LYMFGA........YFFLGP..RK--------FLLTTG.VF----FLTYHSMAARVTRAVIWKSKA....IRLVTFYLTG
Q6CSS7_KLULA/54-399VYVIVS........IFIFSS..QK--------LVLIAG.VY----VLTYHSSWSVVTRRLLWKLKV....VRLLVFYITG
Q59WI8_CANAL/24-381LNFAVS........KTLIPP..QK--------YILFLG.LF----LFTFHSPYSFAIRRLLWRSLY....VRIAILYITG
A3LMZ2_PICST/28-391VYLIVT........FLLIKP..RV--------LLLFSG.LF----VLTYHSAYSRVTRRILWKIKL....ARLLVFYLTG
Q6CXM3_KLULA/59-410CINSLAID....SISSLIPW..KF--------IFLCAGWTF----VISLHPKIRDTMFN.................LMYS
A1CDA3_ASPCL/48-420IWIILTL.....PPFYLITT..RR--------VVMSIG.TI----ILTYHSRPARVSRVILWRSLT....VRRICSMITG
A7E6F1_SCLS1/107-489AFMFIA........SHLMPW..RF--------IFLTIGWTI----TSLGHPTIQRQMLTTH...................
A7TDR4_VANPO/106-455LMNCLFID....TFVNYIPY..KH--------ILLFLGWAV----MFSFHPINRDRFLG.................ILNS
A7TKV5_VANPO/49-397IYVVIS........LFIFPP..RT--------LLLVGG.VY----ILTYQSPWSKVTRRILWKFKA....VRLFVFYLTG
Q6CN25_KLULA/177-532FLLWII........TPFINW..GL--------MASLLAWSI----MTIIHPRVRPTVFG.................LLKK
Q6FJ63_CANGA/118-468VTNIIFID....VLVRIIPI..KL--------ILVATGWAF----IIICHPKYRDNFFN.................KVNS
A6ZZ68_YEAS7/115-465TLNFLYMD....KFIKLIPM..RP--------VLILLGWGF----FIASHPSNREYLLT.................KLNS
Q752S3_ASHGO/50-392IYVILT........LFVIPP..RK--------FVLVAG.VY----VLTYHSSWSSVTRKLLWRFKL....VRLLAFYVTG
Q7S6Z9_NEUCR/280-710FWFL....................--------.........----..............................ELVTG
PEX32_YEAST/26-408FQIIIM........RYISPGTYTR--------FFIITG...----.LIYNTSSFQATLRLLWRFTA....VRNFY.YLGI
A6ZUZ6_YEAS7/50-394VYIFLT........VFVLSP..NY--------LMLIGG.LY----VLTYHSKLIRRMRRYLWKFRV....VRLLVFFITG
Q6FJI4_CANGA/13-429VHYVLM........KVITVHNYSK--------LLILFA...----.LFYHSDWMQVVLRLCWRLLIVRRFYFRVFNYIFG
A4GFD2_PICAN/121-493ILLTLFGA...QVLSTMLPF.IKV--------TLSVGLWAA----TIAMHPNYRSSLLD.................MLYS
A4GFN5_PENCH/56-430VWIGLTL.....PPFYILTT..RR--------IVMAVG.TI----VLTYHSRPARVSRVILWRSRA....VRRLCAAATG
A2R1B9_ASPNC/54-425IWIALTL.....PPLYLITT..RR--------VIMTLG.TI----ILTYHSRPARVSRVILWRSLT....IRRICSIITG
A2QGY9_ASPNC/84-515ALLFLT........AHLLPW..RL--------IFLVGGNAA----ILSMHPSFPDLVQSLA..............EDMLD
Q75AQ6_ASHGO/185-541MGLWII........APYINW..SL--------TSAAGAWAA----LILIHPRVLPMVTA.................YIND
Q2UTA0_ASPOR/52-419IWIALTL.....PPLHLITT..RR--------VILIIG.TI----ILTYHSRPARVSRVILWRSLT....VRRICSLITG
A7TEV3_VANPO/152-511GCLWAL........APYINW..SF--------FFSFNTWLI----LICIHPNIREHLLK.................LMES
A5DUM8_LODEL/24-379LQWVLV........KTVLPP..QK--------FLLIAG.IF----VFSFNSPHAVAIRKLLWRSLY....LRVLVIYITG
Q7S7I8_NEUCR/80-508ALMTVT........AHLIPW..RY--------ICLVAGWLA----ISSNHPTVSRLIGEWQ..............AQYLG
PEX32_SCHPO/1-480ILIFCL............PT..QA--------LFIVLS.SV----FLAWHSPPLQAVLFCIRRISF...FNLLYEKFVIG
Q8NJX0_YARLL/178-534IGTFFL........SAFIPW..KA--------LQIGAGWGV----IIAGHPTLLKRIVA.................ILDE
A4GFD3_PICAN/18-342CYIWLM........TRIFTV..RS--------FLLVFG.VA----CLSFYSSWSVATRHLLWRSIV....IRKILTFTTG
Q0CPT8_ASPTN/42-419IWIALTL.....PPLRLITT..RR--------VVLILG.TI----ILTYHSRPARVARVILWRSLT....IRRICSMITG
Q6FXX0_CANGA/58-376IYVLLG........CLLGNEFIRF--------NIASFG.VL----ILTYHSPWCKTLRRLLWKFKF....VRTVIYRVMG
Q5ACV4_CANAL/52-403VYLVVT........FLLIKP..RT--------ILLLTG.VY----LLTYHSSYSIVTRRILWKLKI....VRLIFFYLTG
PEX28_YEAST/201-569VFLKIL........SPFVNW..SY--------VCSIFAWCL----LIYMHPRAHPKIIS.................FFKT
A5DUZ7_LODEL/104-459IYLVLT........FLFIRP..RT--------ILLFTG.VF----LMTYHSSYSIVIRRILWQIKL....VRLICFYLTG
A7EH28_SCLS1/61-453IWIILTL.....PPIQVITT..KR--------IALVTG.TI----FLTWHSRPNRIARTILWRSSL....VRRICTAITG
Q5ANG0_CANAL/154-573FGILFV........GKYVPW..RL--------IFIQGGWTG----AILCHPNCKKFLVD.................ASKA
Q6FR12_CANGA/140-535ILLVLL........SRFITW..SL--------TISLSAWIG----LLSIHPKVHPYVKS..A............KNIMKK
A5DZV8_LODEL/165-601FGAIFF........GQFIPW..RL--------IFIQSGWIG----LTLCHPKVKKFLVD.................FGAA
Q2GTD2_CHAGB/75-535AWILLTL.....PPLRIITT..RR--------VILILG.TI----LLTWHARVIRVTRVILWRSAT....LRRVLSLVTG
Q6FTU9_CANGA/51-394IYILVT........KLIFYP..RT--------LVLFAG.VY----VLTYHSSWSKAFRRSLWNFRL....IRLLMFYITG

PF08372

Q8S1F8_ORYSJ/928-1080--------------------------------------------------------------------------------
Q403P3_CRYJA/36-191--------------------------------------------------------------------------------
Q5TKJ0_ORYSJ/649-804--------------------------------------------------------------------------------
Q9FJG3_ARATH/893-1049--------------------------------------------------------------------------------
Q8H2Q5_ORYSJ/856-1011--------------------------------------------------------------------------------
A5C8U1_VITVI/865-1020--------------------------------------------------------------------------------
A2XK62_ORYSI/899-1054--------------------------------------------------------------------------------
Q0D8E3_ORYSJ/881-1037--------------------------------------------------------------------------------
Q765H8_FLATR/281-435--------------------------------------------------------------------------------
Q9M2D4_ARATH/816-972--------------------------------------------------------------------------------
Q60EW9_ORYSJ/619-774--------------------------------------------------------------------------------
Q9T0C8_ARATH/702-857--------------------------------------------------------------------------------
Q7XKA3_ORYSJ/864-1021--------------------------------------------------------------------------------
Q9LZE5_ARATH/588-744--------------------------------------------------------------------------------
Q69T22_ORYSJ/477-632--------------------------------------------------------------------------------
Q9FI32_ARATH/881-1036--------------------------------------------------------------------------------
O49435_ARATH/618-774--------------------------------------------------------------------------------
Q9M366_ARATH/632-795--------------------------------------------------------------------------------
Q9SS68_ARATH/861-1017--------------------------------------------------------------------------------
A2XB01_ORYSI/845-999--------------------------------------------------------------------------------
O80558_ARATH/628-783--------------------------------------------------------------------------------
Q01IK6_ORYSA/659-814--------------------------------------------------------------------------------
Q6EUH5_ORYSJ/624-779--------------------------------------------------------------------------------
A5BPW2_VITVI/822-977--------------------------------------------------------------------------------
O65279_ARATH/520-675--------------------------------------------------------------------------------
Q2HRE0_MEDTR/921-1076--------------------------------------------------------------------------------
Q43085_PEA/213-368--------------------------------------------------------------------------------
Q93ZA2_ARATH/514-669--------------------------------------------------------------------------------
O64492_ARATH/857-1012--------------------------------------------------------------------------------

PF06398

Q758I9_ASHGO/63-412EETR............................................................LKVLTMTNKIEQLIND
Q4WG87_ASPFU/114-487LSFS...........................................................LNANQSQSLWAQSHGHA
A3GFP1_PICST/23-380LDIKIT....................................K..................KYNPADFQSISRVQSPTSS
Q6BWT4_DEBHA/130-546KKAKK..........................................................VKDVKESKEKEGRFERH
Q6BIC3_DEBHA/22-384LNIKLD.......................................................RTNQNHFMNISIIHSPNTS
A3GHG6_PICST/131-541KKARAA.......................................................KAPQPEEIIESEVKKFETN
Q0UCD7_PHANO/96-443KLLS............................................................DTEHEGRSFLLTISKA
Q6BPA3_DEBHA/104-486EETR............................................................LYFVNLDNQIEEFLLD
A5DFV2_PICGU/131-552KKRKAA....................................A..................KPKKVKEEKDEDGPAVYDR
Q0V1J3_PHANO/49-353LDFGDT.......................................................ISADKKGAPPLPPRKKSTQ
A5DFP0_PICGU/28-381LDFQ............................................................NRN.....HIFAAAFA
Q6BYT2_DEBHA/63-426LDFS...........................................................QARNHSLFAAAFAKVHK
A4GFC7_PICAN/70-420LIFE............................................................SGNNEKSSL.FKTAMN
A7A1K7_YEAS7/58-403LDLG............................................................GINKDQ.GI.FATVQK
Q9UV60_YARLL/25-364LDFS............................................................NTKRNLGAFGFTQSPL
Q6CSS7_KLULA/54-399LDLS............................................................GVNKHQGGI.FAAVHK
Q59WI8_CANAL/24-381LDIKIR....................................K..................DYDPNDYQTVSRVASASNS
A3LMZ2_PICST/28-391LDFS............................................................QAKN..SSL.FAAAFA
Q6CXM3_KLULA/59-410EETR............................................................LRILTKMNHIERIIND
A1CDA3_ASPCL/48-420LSFSLDA...................................N.K................SQS.......LWAQSHG..
A7E6F1_SCLS1/107-489....TA....................................I.V................QPRARPLQ..TNLETFIAH
A7TDR4_VANPO/106-455EETR............................................................LRVLTVTNKLEELMNN
A7TKV5_VANPO/49-397LDLG............................................................GINKNQGII..AAVHK
Q6CN25_KLULA/177-532EQLDK.........................................................GK.......EALRRTERY
Q6FJ63_CANGA/118-468EETR............................................................LRLLKLTSSYDDWVND
A6ZZ68_YEAS7/115-465EETR............................................................LKTLTISTNLESKILQ
Q752S3_ASHGO/50-392LDLS............................................................GVNKYQGGI.FAAVHK
Q7S6Z9_NEUCR/280-710LQFEKPVKVS............................PAEKS.GVAS.........SAASTASGSSANKKTFANIKSTK
PEX32_YEAST/26-408ESFKISSFLPK...........................HLKME.QIIPL.......SQGRAITVPLVEVLPKLLRDKKGD
A6ZUZ6_YEAS7/50-394LDLG............................................................GPDNNR.RL.FASVNK
Q6FJI4_CANGA/13-429DEYTLLGNNSKFGLKTLNLQHIMHLTSNCYLQIPLPLNAVTKMKENHLLEILLLRYLNKNSKALENDDNIIKEFDSKTTA
A4GFD2_PICAN/121-493EDTR............................................................LRLLTMSNRLELWLNK
A4GFN5_PENCH/56-430LSVADTL...................................S.S................PQK.......APAQAQGEK
A2R1B9_ASPNC/54-425LSFSSTV...................................D.K................AQS.......LLMQSQG..
A2QGY9_ASPNC/84-515NTAEEGPAADKK........................GQESFNL.GGLAMP.....ASPSKAVSLMES...........LA
Q75AQ6_ASHGO/185-541DQLEK.........................................................GK.......VVIENVERY
Q2UTA0_ASPOR/52-419LSFSLNV...................................D.K................TPS.......TRTQSHG..
A7TEV3_VANPO/152-511DKVEE.........................................................GR.......KALEKKERY
A5DUM8_LODEL/24-379VNFKVN....................................R..................AFESQEALVISSSSASEGD
Q7S7I8_NEUCR/80-508GEKEPSATAQAV........................HDNDKKL.EQIQNHP....PGPSPDSSLAAE....RAFDAWVRS
PEX32_SCHPO/1-480KTKEPAKPVPQP.........................SSNEPP.APSAEN......KQPSVSSPEKKESPATHLLKVIGS
Q8NJX0_YARLL/178-534LEKSDD.......................................................EEKPKESPVIAILQKVQKK
A4GFD3_PICAN/18-342LKFS........................................................................LVDK
Q0CPT8_ASPTN/42-419LSFSLTV...................................D.K................SKS.......LLTQSHG..
Q6FXX0_CANGA/58-376IQTY............................................................EVQEPKINL.......
Q5ACV4_CANAL/52-403LDLS............................................................ETKN..HSL.FAAAFA
PEX28_YEAST/201-569GTMGK.........................................................EY.......KNLKKREHQ
A5DUZ7_LODEL/104-459LDLS............................................................QTRN..HSL.FAAAFA
A7EH28_SCLS1/61-453LHLTDELS................................PAA.SGN............DGKPP.......LPPRTSSSS
Q5ANG0_CANAL/154-573RKARAAIEKAK..........................KEEKSV.PEIII.......EEADDTVTQFD...........RN
Q6FR12_CANGA/140-535PKMKPE.......................................................NSPQDVAVVMEDNISGEDY
A5DZV8_LODEL/165-601KKRRSKVIQRNA........................EAAQKAD.PTAETTS....NKGLKQLLTQLD...........RN
Q2GTD2_CHAGB/75-535LPFEGTTE................................AAS.ATT............AATKSATSSAAMSNAKTPSTP
Q6FTU9_CANGA/51-394LDMG............................................................GINKHY.TI.FTSVND

PF08372

Q8S1F8_ORYSJ/928-1080-------------------------------------------------------------MFRD.PMPPAAVNFF----
Q403P3_CRYJA/36-191-------------------------------------------------------------RFRH.RLPSVPLNFF----
Q5TKJ0_ORYSJ/649-804-------------------------------------------------------------RFRS.RMPSVPFNFY----
Q9FJG3_ARATH/893-1049-------------------------------------------------------------IFRD.RKPSPVLNFF----
Q8H2Q5_ORYSJ/856-1011-------------------------------------------------------------RFRH.KVPSAPVNFF----
A5C8U1_VITVI/865-1020-------------------------------------------------------------RFRG.RLPSAPINFF----
A2XK62_ORYSI/899-1054-------------------------------------------------------------RFRG.DMPSAGFNFF----
Q0D8E3_ORYSJ/881-1037-------------------------------------------------------------MFRD.RMPAPAINFF----
Q765H8_FLATR/281-435-------------------------------------------------------------..RNKRLPSVPINFF----
Q9M2D4_ARATH/816-972-------------------------------------------------------------RFRG.KTPPGPINFF----
Q60EW9_ORYSJ/619-774-------------------------------------------------------------RFRH.KMPSVPLNFF----
Q9T0C8_ARATH/702-857-------------------------------------------------------------RFRH.RLPSVPVNFF----
Q7XKA3_ORYSJ/864-1021-------------------------------------------------------------RFRS.KQPSVPFNFY----
Q9LZE5_ARATH/588-744-------------------------------------------------------------PLRN.DMPCGVSNFF----
Q69T22_ORYSJ/477-632-------------------------------------------------------------RFRS.RLPAVPSNFF----
Q9FI32_ARATH/881-1036-------------------------------------------------------------KFRS.KLPSLPSNFF----
O49435_ARATH/618-774-------------------------------------------------------------RVRVFDIPSIPQNFF----
Q9M366_ARATH/632-795-------------------------------------------------------------WFRN.NLPDGSLNFF----
Q9SS68_ARATH/861-1017-------------------------------------------------------------RFRD.DMPSVPVNFF----
A2XB01_ORYSI/845-999-------------------------------------------------------------RFRS.RMPSPLMNFF----
O80558_ARATH/628-783-------------------------------------------------------------RFRS.RMPSVPANFF----
Q01IK6_ORYSA/659-814-------------------------------------------------------------RFRS.RMPSAAGNFF----
Q6EUH5_ORYSJ/624-779-------------------------------------------------------------ILRQ.RLPDVVANFF----
A5BPW2_VITVI/822-977-------------------------------------------------------------RFRG.DMPSVPFNFF----
O65279_ARATH/520-675-------------------------------------------------------------KLRH.RIPSAPVNFF----
Q2HRE0_MEDTR/921-1076-------------------------------------------------------------KLRG.KLPSAPVNFF----
Q43085_PEA/213-368-------------------------------------------------------------MFRS.KVPPAPVNFY----
Q93ZA2_ARATH/514-669-------------------------------------------------------------KFRS.KMPSAPSNFF----
O64492_ARATH/857-1012-------------------------------------------------------------RFRR.KLPSRGLSFF----

PF06398

Q758I9_ASHGO/63-412..YWD......YCEPRET.R.......................QAAIFEIQKFDRRTK...EWRTAGFSSDDYTLL....
Q4WG87_ASPFU/114-487..ASI......ATRRRGD.S..................SGVRFTFVLYENQRRW.LGI...GWTYSLFPSERAAWT....
A3GFP1_PICST/23-380..DIEELNNVPLLTDFKI.LKKSM.........VSPTQLKQIILFELLENERRW.IGL...GWSNLLLPNERANFV....
Q6BWT4_DEBHA/130-546..DII......IDDSAEI.R.......................IVEVFELQNKNMSNN...QWSFHRYTSNMFDIK....
Q6BIC3_DEBHA/22-384..DIE.....DFDENQKP.LQLLGDFKILKKTVISPTQLRQVVTFEILENERRW.VGV...GWSKFVLPGDRPSYC....
A3GHG6_PICST/131-541..DII......VDDAPER.R.......................IVEIFELQKKSILHE...KWTFYSYSGNIFDTK....
Q0UCD7_PHANO/96-443..DIE......LEPTQES.R.......................EVEIFELQHRALHDEH.GEYEGFMFSSSPYSPL....
Q6BPA3_DEBHA/104-486..LIV......KVDDEQV.K...................IETKQVEIFELQRYDKTSK...IWELNGFTNDFYTIN....
A5DFV2_PICGU/131-552.NDII......IDDAPEV.R.......................ICEIFELQVKSLTKN...EWSFYCFTSSAFDVK....
Q0V1J3_PHANO/49-353..EVA......ASLAAKR.RP...............ESTGVRFTFSIYENQRRW.LGI...GWTSSMLAYERASWT....
A5DFP0_PICGU/28-381..KVQ......KGNTNNG.LG..............DPNKPVRFAYVVYENQRRW.LGI...GWTANLLSYERAPWT....
Q6BYT2_DEBHA/63-426NAGHS......LDLSSEA.S.................NKPVRFTYVIYENQRRW.LGI...GWTSNLLSYERTPWT....
A4GFC7_PICAN/70-420KTNKK......LKE...V.TRKA..........GGKHSGPVRFTYVLYENQRRW.LGV...GWTPNLLSYERTPWT....
A7A1K7_YEAS7/58-403QVKKL......AS....T.ENSNG.........VLSDSKPIRFTYVLYENQRRW.LGI...GWKPSMLSYERTPWT....
Q9UV60_YARLL/25-364SVQS................K...............DGKPVRFTYVLYENQRRW.LGI...GWTANLLAYERTPWT....
Q6CSS7_KLULA/54-399KVKNL......SS....S.SIGT..........DADDGKPIRFTYVLYENQRRW.LGI...GWTANMLTYERSSWT....
Q59WI8_CANAL/24-381DAEGLGG..IPVLSDFKI.IKKRV.........VSPTQLKQTVVFEVLENERRW.LGV...GWSSLLYPSERPNFC....
A3LMZ2_PICST/28-391KVQKN......AGFDNKS.SEG............VSSNKPVRFTYVIYENQRRW.LGI...GWTSNLLSYERTPWT....
Q6CXM3_KLULA/59-410..KFD......SYEPRER.R.......................EASIFELQRFNAEEK...SWELVGYSTDEYALF....
A1CDA3_ASPCL/48-420..HA..........ATIA.TRR............RGDSSGVRFTFVIYENQRRW.LGI...GWTYSLFPSERAPWT....
A7E6F1_SCLS1/107-489..NII......LDSSPET.R.......................EVEIFELQKLSRAG....EWEHWLFSTSPYDPL....
A7TDR4_VANPO/106-455..ELK......TVEASER.K.......................LVAVYEIQKLG.EKS...EWVPIGFSNDSYTLF....
A7TKV5_VANPO/49-397QVRKL......SSPTQTD.VSQP..........GAMPNKTIRFTYVLYENQRRW.IGI...GWTSSMLSYERTPWT....
Q6CN25_KLULA/177-532..DIL......LDEPVET.R.......................WVEVFEIQMQGITEQ...EWSPYMYSTQVFDKS....
Q6FJ63_CANGA/118-468..NLG......YVEARET.K.......................VVIIYEMQKYKDKHK...EWHPVGYANDDFTLF....
A6ZZ68_YEAS7/115-465..HLK......LIEAREH.R.......................LVMIFEIQKYLPEYK...EWRPVGFSDDDYSLF....
Q752S3_ASHGO/50-392KVKKL......SG.......TNG...........ADDGKPIRFTYVLYENQRRW.LAI...GWTSNMLSYERSSWT....
Q7S6Z9_NEUCR/280-710..AYN......AQESELTKALRRA.........RGGHDTGVRFTFIIYENQRRW.VGL...GWTTSLFAYERPAWT....
PEX32_YEAST/26-408..DHI......HILQLLL.NEQKD.........NFGNEDLKILEIEVYENQRRWYQNK...NWSTKLLPYERQNYCIEI.
A6ZUZ6_YEAS7/50-394KIRSF......VW....N.EVGN..........TSNTKKTVLFKVALFENQRRW.LGI...GWTSTMLSYERASWT....
Q6FJI4_CANGA/13-429..DVV......PKENTTD.ESATT.........SYNSSKVKIKEIVVFENQRKWKYK....GWISKMLPYERPQFTTNCN
A4GFD2_PICAN/121-493..ELN......LREQKEV.K.......................ETEIFELQHLNPETH...NWQLICFSSDPYPAN....
A4GFN5_PENCH/56-430..QG..........LNIS.TRR............RGNNAGVRFTFVVYENQRRW.LGI...GWTYSLFPAERDPWT....
A2R1B9_ASPNC/54-425..HA..........MSIA.TRR............RGDSSGVRFTFVISENQRRW.LGI...GWTYSLFPSERAAWT....
A2QGY9_ASPNC/84-515..NIS......LDSSPEE.R.......................EVEVFEIQYRSLAPYSESQWEHFLFSPMPYDPL....
Q75AQ6_ASHGO/185-541..DIL......LDEKPEE.R.......................YLELFEIYKQRLTSD...EWDFYLLSSYAFDPT....
Q2UTA0_ASPOR/52-419..HA..........ASVA.TRR............RGESSGVRFTFILYENQRRW.LGI...GWTYSLFPSERAAWT....
A7TEV3_VANPO/152-511..DVI......LDEKPEV.K.......................HVEIFEILEQGITPH...HWKFYKFSNQVFDPH....
A5DUM8_LODEL/24-379ESEILT....PVLSNFKV.VKKKM.........ISPTRLKQSVVFEVLENERRW.FGI...GWSSMLYPNERPNFC....
Q7S7I8_NEUCR/80-508..DII......LDDAPET.R.......................EVEIFELQRLSDTSG...EWEPWLFSPSPYDPL....
PEX32_SCHPO/1-480..SPY......VVHSNHT.NNTLT.........DKESSDPTEKCLYLIEHQRYW.VGV...GWLNRTLPTDPPNFT....
Q8NJX0_YARLL/178-534..EFI......NDEPPQG.E.......................TVEIFELQRQGLTPR...QWDSWVFTSLVYDLG....
A4GFD3_PICAN/18-342NIELT......VLNDFQI..S..............NIGTGKTVEFHILQNQRRW.LGV...GWSNTLLPFERGPFT....
Q0CPT8_ASPTN/42-419..HA..........ASIA.TRR............RGDSSGVRFTFVLYENQRRW.LGI...GWTYSLFPSERAAWT....
Q6FXX0_CANGA/58-376.....................................DKKYKFTYVLYENQRRW.LGI...GWKSSMLSYERTPWT....
Q5ACV4_CANAL/52-403KV...............S.SSGT..........SSKSNKPVRFTYVIYENQRKW.LGI...GWTSNLLSYERTPWT....
PEX28_YEAST/201-569ALNMI......FDEQPET.K.......................FIEIFEIYKKALLPN...DWKFFRYSNRIFDPQ....
A5DUZ7_LODEL/104-459KVQSN............S.QDGL..........GRGSTKPVRFTYVIYENQRRW.LGI...GWTSNLLSYERTAWT....
A7EH28_SCLS1/61-453..ADA......TLVADAA.ITR............RLEAPGVKFTFIIYENQRRW.VGL...GWTTSLFAYERSAWT....
Q5ANG0_CANAL/154-573..DII......VDDSPEA.R.......................TVEIYELQIKSILKH...SWTFYRYSTTIYDKN....
Q6FR12_CANGA/140-535NRNII......LDEPPDV.K.......................YVEVYEIYKRGLLPT...DWEFFKFSSTIFDPT....
A5DZV8_LODEL/165-601..DII......VDDSPEV.R.......................LVEVYELEIKSILQN...DWKFYRYSNTIYDRL....
Q2GTD2_CHAGB/75-535GGAKS......PRESELTKALRRA.........RGGRGTGVRFTFIIYENQRRW.VGI...GWTTSLFGYERPAWT....
Q6FTU9_CANGA/51-394QIKKL......TG....P.KKAD...........GSSNEPIRFTYVLYENQRRW.IGI...GWTSSMLSYERSAWT....

PF08372

Q8S1F8_ORYSJ/928-1080----------RRLPS--------------------------LSDRML---------------------------------
Q403P3_CRYJA/36-191----------RRLPA--------------------------RSDSML---------------------------------
Q5TKJ0_ORYSJ/649-804----------RRLPA--------------------------KSDMLL---------------------------------
Q9FJG3_ARATH/893-1049----------RRLPS--------------------------LSDRLM---------------------------------
Q8H2Q5_ORYSJ/856-1011----------RRLPA--------------------------KTDSLL---------------------------------
A5C8U1_VITVI/865-1020----------RRLPA--------------------------KTDSML---------------------------------
A2XK62_ORYSI/899-1054----------RRLPS--------------------------NSDRVL---------------------------------
Q0D8E3_ORYSJ/881-1037----------RRLPS--------------------------MSERIM---------------------------------
Q765H8_FLATR/281-435----------SRLPA--------------------------RTDSML---------------------------------
Q9M2D4_ARATH/816-972----------RRLPA--------------------------KTDCML---------------------------------
Q60EW9_ORYSJ/619-774----------RRLPA--------------------------RTDSML---------------------------------
Q9T0C8_ARATH/702-857----------RRLPA--------------------------RTDSML---------------------------------
Q7XKA3_ORYSJ/864-1021----------KRLPA--------------------------KSDVLL---------------------------------
Q9LZE5_ARATH/588-744----------RRLP.--------------------------.TNEVL---------------------------------
Q69T22_ORYSJ/477-632----------RRLPS--------------------------RADSML---------------------------------
Q9FI32_ARATH/881-1036----------KRLPS--------------------------STDSLL---------------------------------
O49435_ARATH/618-774----------RRLPS--------------------------RADSIL---------------------------------
Q9M366_ARATH/632-795----------RRLPS--------------------------NEDLMF---------------------------------
Q9SS68_ARATH/861-1017----------RRLPS--------------------------MSDQIL---------------------------------
A2XB01_ORYSI/845-999----------RRLPS--------------------------KADSLL---------------------------------
O80558_ARATH/628-783----------KRLPA--------------------------KSDMLL---------------------------------
Q01IK6_ORYSA/659-814----------KRLPS--------------------------RADTML---------------------------------
Q6EUH5_ORYSJ/624-779----------RRLPC--------------------------KVDCLL---------------------------------
A5BPW2_VITVI/822-977----------RRLPS--------------------------LSDQIL---------------------------------
O65279_ARATH/520-675----------RRLPA--------------------------MTDSML---------------------------------
Q2HRE0_MEDTR/921-1076----------RRLPA--------------------------LTDSML---------------------------------
Q43085_PEA/213-368----------RRLPA--------------------------LTDSML---------------------------------
Q93ZA2_ARATH/514-669----------RKLPS--------------------------KADCML---------------------------------
O64492_ARATH/857-1012----------RRLPS--------------------------RADSLL---------------------------------

PF06398

Q758I9_ASHGO/63-412...SKLRIAEEPIDS......................SATSLDDVKPPL.....................DWKWLG....
Q4WG87_ASPFU/114-487...DE...HLNPAPS..........................KDDFELPHVQA...............GNAKWRWVE....
A3GFP1_PICST/23-380...HE..KSLAAAPS......................VENTRDDYPFPIFEND.............IYSYSWDWLD....
Q6BWT4_DEBHA/130-546...NHARAAGKR.PL......................GVDDLSKVLPPP.....................DWKFDMG...
Q6BIC3_DEBHA/22-384...YE..QSMKPSPS.......................ISNDESFNFPIFEND.............LYTYSWEWLE....
A3GHG6_PICST/131-541...KKTRLAGKR.PG......................GVDHLSKVVPPK.....................DWLFDFG...
Q0UCD7_PHANO/96-443...SPARISGDK.PR......................GTPFFEDVLPPR.....................GWRWAD....
Q6BPA3_DEBHA/104-486...SPMRKLKQEYLKGKNNDKNDDEEDGEKSENVDINTVPHINAIKPPI.....................DWEFNE....
A5DFV2_PICGU/131-552...NSTRSAGKK.PQ......................GVNHLYKILPPP.....................DWKFDMS...
Q0V1J3_PHANO/49-353...DE...HLNAVPP..........................KDQFELPEVEG...............GQSRWRWVQ....
A5DFP0_PICGU/28-381...DE...FLNESPS..........................VDKFELPSPDNDYSSGS...SAMPMASGATWRWVD....
Q6BYT2_DEBHA/63-426...DE...FLNESSS..........................LESFQLPNNENNDYSFGAQQSQQLSGSDTTWRWVD....
A4GFC7_PICAN/70-420...DE...FLNEAES..........................PDNFELPQLND..............DSGMYWRWID....
A7A1K7_YEAS7/58-403...DE...FLNEAPS..........................PENFHLPEET................NTMVWRWVD....
Q9UV60_YARLL/25-364...DE...FLNEVTP..........................PSEFKLPDTEG...............TGMKWQWVD....
Q6CSS7_KLULA/54-399...DE...FLNEAPS..........................PEQFKLPEEA................SGMAWRWVD....
Q59WI8_CANAL/24-381...YEG..SYNLAPN......................ITVHKENFPFPVFEND.............LYAYSWEWID....
A3LMZ2_PICST/28-391...DE...FLNESSS..........................IESFKLPNTSDDKNFNNP.SESLGRINGATWRWVD....
Q6CXM3_KLULA/59-410...SESRMKELSTSQI....................PNVQTLAEVKPPA.....................EWDWLL....
A1CDA3_ASPCL/48-420...DE...HLNAVPP..........................KDDFELPEVQG...............GNAKWRWAE....
A7E6F1_SCLS1/107-489...SSMRIEIGR.PI......................GCRFFEDVKSPR.....................GWEWSE....
A7TDR4_VANPO/106-455...STLRINEQKIER.....................RCASHLEEVMPPI.....................DWEWVN....
A7TKV5_VANPO/49-397...DE...FLNQAPS..........................PEDFTLPEES................SDLTWKWVD....
Q6CN25_KLULA/177-532...DPYRKSQKP.PP......................GAHSMDDLKPPP.....................TWTFDS....
Q6FJ63_CANGA/118-468...SQFRINENAIES.....................VAVPSLDSISPPT.....................GWEWAE....
A6ZZ68_YEAS7/115-465...SSLRIYQRRIEE.....................NSVKSLEEIEPPK.....................DWEWEA....
Q752S3_ASHGO/50-392...DE...FLNEAPP..........................PEKFKLPEEN................GGMVWRWVD....
Q7S6Z9_NEUCR/280-710...DE...HNNAVPP..........................RDQFELPEVED..............GSNMRWRWVE....
PEX32_YEAST/26-408KNTDGTLTMRSCLPP........................DGLGEEELPN.....................NWHWIN....
A6ZUZ6_YEAS7/50-394...DE...FLNTSPS..........................PEVFTLPEEQ................SGMAWEWHD....
Q6FJI4_CANGA/13-429NKYNDPGAYITESPE..........................QLDLQVPP.....................DWSWIE....
A4GFD2_PICAN/121-493...SHTRLNNLPLV.......................GTLHLSQVKPPE.....................GWRFVDVETA
A4GFN5_PENCH/56-430...DE...HMNPVNP..........................KDSFELPEVQT...............GDAKWRWVE....
A2R1B9_ASPNC/54-425...DE...HLNHVPS..........................KEEFELPGVAN...............GNAQWRWVE....
A2QGY9_ASPNC/84-515...SPSRIAGDR.PK......................GCRFFEDVQPPS.....................GWAWKG....
Q75AQ6_ASHGO/185-541...DKYRKSQRP.PP......................GVTNIDEVVPPS.....................MWSFDR....
Q2UTA0_ASPOR/52-419...DE...HLNNVPS..........................KDEFELPEVQS...............GNAKWRWVE....
A7TEV3_VANPO/152-511...DQYRKLQQP.PP......................GVDNLKDIEPPR.....................TWYFDE....
A5DUM8_LODEL/24-379...FEK..TMEVAPS......................ITTEPDDFPFPVFEND.............VYSYQWNWSD....
Q7S7I8_NEUCR/80-508...SAARIAGDR.PT......................GTRFFEDVLPPE.....................GWEWSG....
PEX32_SCHPO/1-480...NAGSTDPVAEPT...........................AQLLPPD.....................GLAWID....
Q8NJX0_YARLL/178-534...SSWRQAKKR.PP......................GAPFLGDVEAPE.....................GWLFSK....
A4GFD3_PICAN/18-342...TED..LEKSWDS..........................LESFQFPEITQ...............ATCRWRWLD....
Q0CPT8_ASPTN/42-419...DE...HLNQVPS..........................KDEFELPQVQS...............GNAKWRWVE....
Q6FXX0_CANGA/58-376...DE...FLNEAPK..........................PSDFQLPN....................KEWKWLD....
Q5ACV4_CANAL/52-403...DE...FLNESSS..........................IDSFKLPNAADDATN......GDSNMQGATWRWVD....
PEX28_YEAST/201-569...DPYRRAQQF.PP......................GVDSLADVIPPT.....................GWSFDP....
A5DUZ7_LODEL/104-459...DE...FLNESSS..........................IETFKLPNTTDSNNLP.....ITSDIEGASWRWVD....
A7EH28_SCLS1/61-453...DE...HLNPVPP..........................KEEFELPDVEG...............GGARWRWVK....
Q5ANG0_CANAL/154-573...NKARIAGKR.PP......................GVDHLSKVYPPN.....................DWKFDFG...
Q6FR12_CANGA/140-535...DTYRKALQL.PP......................GVDKIEEIKPPA.....................GWAFDE....
A5DZV8_LODEL/165-601...NKNRLSGKR.PP......................GVDHLSKVFPPT.....................DWKFDAE...
Q2GTD2_CHAGB/75-535...DE...HNNAVPP..........................RAEFELPEVED..............GSNMRWQWAE....
Q6FTU9_CANGA/51-394...DE...FLNAAPP..........................ITEFTLPEGD................SGLEWKWID....

PF08372

Q8S1F8_ORYSJ/928-1080--------------------------------------------------------------------------------
Q403P3_CRYJA/36-191--------------------------------------------------------------------------------
Q5TKJ0_ORYSJ/649-804--------------------------------------------------------------------------------
Q9FJG3_ARATH/893-1049--------------------------------------------------------------------------------
Q8H2Q5_ORYSJ/856-1011--------------------------------------------------------------------------------
A5C8U1_VITVI/865-1020--------------------------------------------------------------------------------
A2XK62_ORYSI/899-1054--------------------------------------------------------------------------------
Q0D8E3_ORYSJ/881-1037--------------------------------------------------------------------------------
Q765H8_FLATR/281-435--------------------------------------------------------------------------------
Q9M2D4_ARATH/816-972--------------------------------------------------------------------------------
Q60EW9_ORYSJ/619-774--------------------------------------------------------------------------------
Q9T0C8_ARATH/702-857--------------------------------------------------------------------------------
Q7XKA3_ORYSJ/864-1021--------------------------------------------------------------------------------
Q9LZE5_ARATH/588-744--------------------------------------------------------------------------------
Q69T22_ORYSJ/477-632--------------------------------------------------------------------------------
Q9FI32_ARATH/881-1036--------------------------------------------------------------------------------
O49435_ARATH/618-774--------------------------------------------------------------------------------
Q9M366_ARATH/632-795--------------------------------------------------------------------------------
Q9SS68_ARATH/861-1017--------------------------------------------------------------------------------
A2XB01_ORYSI/845-999--------------------------------------------------------------------------------
O80558_ARATH/628-783--------------------------------------------------------------------------------
Q01IK6_ORYSA/659-814--------------------------------------------------------------------------------
Q6EUH5_ORYSJ/624-779--------------------------------------------------------------------------------
A5BPW2_VITVI/822-977--------------------------------------------------------------------------------
O65279_ARATH/520-675--------------------------------------------------------------------------------
Q2HRE0_MEDTR/921-1076--------------------------------------------------------------------------------
Q43085_PEA/213-368--------------------------------------------------------------------------------
Q93ZA2_ARATH/514-669--------------------------------------------------------------------------------
O64492_ARATH/857-1012--------------------------------------------------------------------------------

PF06398

Q758I9_ASHGO/63-412.....KYDWVLDLEPRQWVTDGFV..QYVDIDAETK.................WVYD.......................
Q4WG87_ASPFU/114-487.....GSEWRIEGADDTNSK...........ADGKAADG............GGWIYY.......................
A3GFP1_PICST/23-380......TDWRLDSD....FN...........NKGSKD...............GWVYY.......................
Q6BWT4_DEBHA/130-546....YANKWEIDIDPQKFFKERNINNPYLQVHEDEKE...............GWIYD.......................
Q6BIC3_DEBHA/22-384......TNWKVDKE.................FNKGKGS.............EGWVYY.......................
A3GHG6_PICST/131-541....FANKWTIDYEPQEFLRQRSLE.SKNLVIREGEKS..............GWIYD.......................
Q0UCD7_PHANO/96-443......KKWTLDLLSREWVEDRCV..TGVEVEIEGER................WVTD.......................
Q6BPA3_DEBHA/104-486......ESWKLDLNVNDWVNSNLLA.DLVMIDTDEK.................WVYD.......................
A5DFV2_PICGU/131-552....YADNWHVDKEPQNFLKERSW..DKLNMFVIKEDED............EGWMYD.......................
Q0V1J3_PHANO/49-353.....GSSWKIETG..GDTK...........TTTKDDA..............GWIYY.......................
A5DFP0_PICGU/28-381......KSWRLDLTNDGAIT...........LNKRSKTTADP......GPDEGFIYY.......................
Q6BYT2_DEBHA/63-426......KTWRLDLTNDGAIT...........LQNNKRSKTTAN....PATDEGYIYY.......................
A4GFC7_PICAN/70-420......KTWRLDLTNDGALQ...........LPSSKYKTTAD.....PKPDEGFIYY.......................
A7A1K7_YEAS7/58-403......KTWRLDMTNDGAIQ...........VPNSKARTSAD.....PSPDEGFIYY.......................
Q9UV60_YARLL/25-364......PTWRLDCTNDGALV...........IIGNKALSTPD.....PSPSEGWIYY.......................
Q6CSS7_KLULA/54-399......KTWRLDMTNDGAIQ...........LSSTRPKTTAS.....PGADDGFIYY.......................
Q59WI8_CANAL/24-381......DDWSLELE.......................YQKS.......KAHDGWVYF.......................
A3LMZ2_PICST/28-391......KAWRLDLTNDGAIT...........LTNSKRSKTTAN....PSPDEGFIFY.......................
Q6CXM3_KLULA/59-410.....NVDWTLDLHPTEWVSAGFI..QYVDVDNETK.................WVYD.......................
A1CDA3_ASPCL/48-420.....GSEWRIEGA...DG............TKDKSESKAA........DGGGWIYY.......................
A7E6F1_SCLS1/107-489.....K.KWALDLWSREWVEERII..TGVEVETEGER................WVYDIKYEGEEEDSVGVLD........
A7TDR4_VANPO/106-455.....NSKWVLDLEPTEWVERNFV..QFVEIDSETK.................WVYD.......................
A7TKV5_VANPO/49-397......KSWRLDLTNDGAIQ...........LPSSKQRTTAS.....PGADEGFIYY.......................
Q6CN25_KLULA/177-532.....NSEWTTDTNVEQWATERG....LEMTRIEGD.................YLVD.......................
Q6FJ63_CANGA/118-468.....NSSWVLDLDPTGWVEEGFI..QFVQIDPETK.................WVYD.......................
A6ZZ68_YEAS7/115-465.....NSHWVLDLDPKEWVEDEFI..QYVEIDSETK.................WVYD.......................
Q752S3_ASHGO/50-392......KTWRLDLTNDGAIH...........LPSSRSKTTAS.....PNSDDGFIYY.......................
Q7S6Z9_NEUCR/280-710.....GSRWRVDGVPDEAV............MPGE.DADGKEWDYDSPGGRMGWVYY.......................
PEX32_YEAST/26-408......DNWDGTD........................................WIYS.......................
A6ZUZ6_YEAS7/50-394......KDWMLDLTNDGIIQ...........LPASAAKTKVK.....PGADEGFIYY.......................
Q6FJI4_CANGA/13-429......KEWTVSS........................................WVYS.......................
A4GFD2_PICAN/121-493VNTRSVDGWLLDLTPEGWIKENFLN.ETMDIDEDEK.................WCYDL......................
A4GFN5_PENCH/56-430.....GSEWRIEGA...DN............FNGKSDSKGS........TGEGWIYY.......................
A2R1B9_ASPNC/54-425.....GSDWRIEGA...D.............ESGKSDAKA.........DGGGWVYY.......................
A2QGY9_ASPNC/84-515.....K.KWELDLDCREWVVERMI..TGVGFEVSGSPSESGMT....SGEIGGWVWDLPPASSRYEEAVSTLAYDV..LD
Q75AQ6_ASHGO/185-541.....NSKWEVDYDVKGWAQERG.....LSLEINGE.................FLVD.......................
Q2UTA0_ASPOR/52-419.....GSEWRIDGA...D..................DASAK........DGGGWIYY.......................
A7TEV3_VANPO/152-511.....NAPWEVDPNAKKWSEERG.....LNLTISGQ.................YLVD.......................
A5DUM8_LODEL/24-379......ESWKVDQE.......................FNRS.......KSIEGWVYY.......................
Q7S7I8_NEUCR/80-508.....K.KWALDLWSREWVEERII..TGVEVETEGER................WVYDIYNEHENGVNGSDNGDLGAALGD
PEX32_SCHPO/1-480......DKWSISP........................................WTFT.......................
Q8NJX0_YARLL/178-534.....MHDWEVDMNPNEWVGERGLG.RCTEMDNDE..................WVYD.......................
A4GFD3_PICAN/18-342......AKWKTDDS.......................FAP..........GEGWIYY.......................
Q0CPT8_ASPTN/42-419.....GSEWRIDGG...DG............ANDKADTKST........DGGGWVYY.......................
Q6FXX0_CANGA/58-376......SEWKLDLSNDGAIE...........VPGERFLTNP.......KENDGYIYY.......................
Q5ACV4_CANAL/52-403......KTWRLDLTNDGAIT...........LSSSKRSKTTAN....PTNDEGFIYY.......................
PEX28_YEAST/201-569.....NFEWKIDNDVDRWVVERG.....LNLPITGE.................FLFD.......................
A5DUZ7_LODEL/104-459......KTWRLDLTNDGAIT...........LPASKHSKTTAN....PTSDEGFVYY.......................
A7EH28_SCLS1/61-453.....GSRWRVEGAAEHDE............GGSNPKAESD........GGAGWIYY.......................
Q5ANG0_CANAL/154-573....LVNKWNLDTKPKEFLRERSL...NPNLFIVKNDES............QGWIYD.......................
Q6FR12_CANGA/140-535.....NSSWIIDKNPEIWAIERG.....LQLPVEEG.................FLVD.......................
A5DZV8_LODEL/165-601....FVNKWVLDTNPMDFIKQRTL...DASLFVIKDDEN............EGWIYD.......................
Q2GTD2_CHAGB/75-535.....GSRWRVDGVQDEAV............TPIDDKTDGWDYD..GPGGRMGWVYY.......................
Q6FTU9_CANGA/51-394......KEWRLDLTNDGSIQ...........LPSSKMKTTAN.....PSSDDGFIYS.......................

PF08372

Q8S1F8_ORYSJ/928-1080---------------------------------------------
Q403P3_CRYJA/36-191---------------------------------------------
Q5TKJ0_ORYSJ/649-804---------------------------------------------
Q9FJG3_ARATH/893-1049---------------------------------------------
Q8H2Q5_ORYSJ/856-1011---------------------------------------------
A5C8U1_VITVI/865-1020---------------------------------------------
A2XK62_ORYSI/899-1054---------------------------------------------
Q0D8E3_ORYSJ/881-1037---------------------------------------------
Q765H8_FLATR/281-435---------------------------------------------
Q9M2D4_ARATH/816-972---------------------------------------------
Q60EW9_ORYSJ/619-774---------------------------------------------
Q9T0C8_ARATH/702-857---------------------------------------------
Q7XKA3_ORYSJ/864-1021---------------------------------------------
Q9LZE5_ARATH/588-744---------------------------------------------
Q69T22_ORYSJ/477-632---------------------------------------------
Q9FI32_ARATH/881-1036---------------------------------------------
O49435_ARATH/618-774---------------------------------------------
Q9M366_ARATH/632-795---------------------------------------------
Q9SS68_ARATH/861-1017---------------------------------------------
A2XB01_ORYSI/845-999---------------------------------------------
O80558_ARATH/628-783---------------------------------------------
Q01IK6_ORYSA/659-814---------------------------------------------
Q6EUH5_ORYSJ/624-779---------------------------------------------
A5BPW2_VITVI/822-977---------------------------------------------
O65279_ARATH/520-675---------------------------------------------
Q2HRE0_MEDTR/921-1076---------------------------------------------
Q43085_PEA/213-368---------------------------------------------
Q93ZA2_ARATH/514-669---------------------------------------------
O64492_ARATH/857-1012---------------------------------------------

PF06398

Q758I9_ASHGO/63-412............................LNFDGTRGQYRRRRWIR
Q4WG87_ASPFU/114-487..................DNK..WNDGRRGQDGWDRYTRRRKWCR
A3GFP1_PICST/23-380..................DNN..WTNGSN.RDGFSKYTRSRKWIR
Q6BWT4_DEBHA/130-546........................KLDGVDNSDSSYEFRRRRLSR
Q6BIC3_DEBHA/22-384..................DNN..WSTESY.SDGFSKFTRSRKWVR
A3GHG6_PICST/131-541.......................KDVESQ.SSDITYEFRRRRLYR
Q0UCD7_PHANO/96-443............................LHYEVLESDGEREKAKR
Q6BPA3_DEBHA/104-486............................LESLTTPEFFRRRRWVR
A5DFV2_PICGU/131-552........................NEDMIENKDEQFDFRRRRLTR
Q0V1J3_PHANO/49-353..................DNK..WRDGRRGLDGWGRYTRRRKWYR
A5DFP0_PICGU/28-381..................DNV..WKKPST.EDSYSKYTRRRRWVR
Q6BYT2_DEBHA/63-426..................DNT..WKKPST.EDSFSKYTRRRRWIR
A4GFC7_PICAN/70-420..................DNT..WKNPST.EDSFSKYTRRRRWIR
A7A1K7_YEAS7/58-403..................DNT..WKKPSK.EDSFSKYTRRRRWVR
Q9UV60_YARLL/25-364..................DNT..WKRPTA.DDSFSKYTRRRRWVR
Q6CSS7_KLULA/54-399..................DNT..WKKPST.EDSFSKYTRRRRWIR
Q59WI8_CANAL/24-381..................DSN..WGNGRV.RDGFSRYTRSRKWTR
A3LMZ2_PICST/28-391..................DNT..WKKPTT.EDSFSKYTRRRRWIR
Q6CXM3_KLULA/59-410............................VELNGERGQYRRRRWVK
A1CDA3_ASPCL/48-420..................DNK..WNDGRRGQDGWDRYTRRRKWCR
A7E6F1_SCLS1/107-489...AGSRSNMGSVKGKKGVPVSWEESSDVDGVGRRGEWRRRRWIR
A7TDR4_VANPO/106-455............................VNIDGNRGSYRRRMWTN
A7TKV5_VANPO/49-397..................DNT..WKKPST.SDSFSKYTRRRRWIR
Q6CN25_KLULA/177-532...................................DQFKRKRLIR
Q6FJ63_CANGA/118-468............................INLDGKRGKYRRRLWTN
A6ZZ68_YEAS7/115-465............................LNLDGQRGSYRRRMWTN
Q752S3_ASHGO/50-392..................DNT..WKKPST.EDSFSKYTRRRRWIR
Q7S6Z9_NEUCR/280-710..................DNKTQWQNGRRGQDGWGRWTRRRKWYR
PEX32_YEAST/26-408..................DSA..WKEIGQ.YSSLESFTRSRKWKR
A6ZUZ6_YEAS7/50-394..................DNT..WNNPSA.TDTYKKYTRRRRWIR
Q6FJI4_CANGA/13-429..................DTD..WNVTGT.MDSLEGYTRSRIWKR
A4GFD2_PICAN/121-493.................VTKFSYQAGLTTNEKKIRGEVRRRRWIR
A4GFN5_PENCH/56-430..................DNK..WNDGRRGQDGWDRYTRRRKWYR
A2R1B9_ASPNC/54-425..................DNK..WNDGRRGQDGWDRYTRRRKWCR
A2QGY9_ASPNC/84-515SINPSKGHDWKGRKKGKERVSQDYEEKVHTGSHVTGEWRRRRWIR
Q75AQ6_ASHGO/185-541...................................DSFKRRRLTR
Q2UTA0_ASPOR/52-419..................DNK..WNDGRRGQDGWDRYTRRRKWCR
A7TEV3_VANPO/152-511...................................DQFKRRRLTR
A5DUM8_LODEL/24-379..................DNS..WEHPRY.QDGFSKYTRSRKWAR
Q7S7I8_NEUCR/80-508GDYETPVRSQDQSRYTPKIGPTISWEEGEEGMGRRGSWRRRRWVR
PEX32_SCHPO/1-480..................DTF..WAQPAK.TQFRTAFTRSREWRR
Q8NJX0_YARLL/178-534.............................VEKGVRGEWRRRRFIR
A4GFD3_PICAN/18-342..................NNS..WEEPSN.TDSLTRFTRTKRWKR
Q0CPT8_ASPTN/42-419..................DNK..WNDGRRGQDGWDRYTRRRRWCR
Q6FXX0_CANGA/58-376..................DNT..WKNPSI.EDTFSKYTRRRRWIR
Q5ACV4_CANAL/52-403..................DNT..WKKPST.EDTFSKYTRRRRWIR
PEX28_YEAST/201-569...................................PMFKRRRLIH
A5DUZ7_LODEL/104-459..................DNV..WKKPTT.EDSFSKYTRRRRWIR
A7EH28_SCLS1/61-453..................DNK..WQNGRRGQDGWGKYTRRRKWYR
Q5ANG0_CANAL/154-573........................NMEGIVYSDIVYEFRRRRLYR
Q6FR12_CANGA/140-535...................................PMFKRRRLVR
A5DZV8_LODEL/165-601........................NMKNVVNLEIVYEFRRRRLYR
Q2GTD2_CHAGB/75-535..................DNK..WQNGRRGQDGWGRWTRRRKWYR
Q6FTU9_CANGA/51-394..................DNT..WKNPST.EDSFSKYTRRRRWIR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window