Sequence alignment for CL0502

PF01740

SUT22_ARATH/540-662YPMANKTAGL....LTLRISSPLLCF-ANAN-F-IRDRILN--SV--------QE--IEGEENEQ...............
RSBRD_BACSU/161-267APIMPITDGI....GILPLVGE.IDT-HRAR-T-ILESVLE--QC--------SA--LK.....................
S26A2_HUMAN/569-715YKNLQIKPGI....KIFRFVAP.LYY-INKE-C-FKSALYK--QT--------VN--PILIKVAWKKAAK..........
O45016_CAEEL/553-725YETANDIPGI....KIFRFDSP.IYF-GNSE-M-FVRKIHQ--AC--------GL--NPLIVRGELETENKKKDARK...
SULP3_CAEEL/546-696KRDLERIQGN...VCIFRMDAP.LIF-TSSD-R-FTMSVWQ--CV--------KK--W.ERCKSESFVTIE.........
O85703_STRLI/11-115HLRVRHHRGH....TVLEFRGE.IDI-ASAA-E-IAPYLDR--ET--------GR--PG.....................
O04001_SPOST/529-651YKDAQRIPGF....LILATEAP.INF-ANSN-Y-LNERIKR--WI--------EE--ESSAQT.................
SUT32_ARATH/505-623YPQAITRSSL....LILHIDGP.IYF-ANST-Y-LRDRIGR--WI--------DE--EEDKLR.................
Q55814_SYNY3/440-540QILRAANGRI....FMFHLSGP.MSF-GAAK-S-IARRLAI--VE--------NY--.......................
RSBV_BACSU/4-107NVDVKQNEND....IQVNIAGE.IDV-YSAP-V-LREKLVP--LA--------EQ--G......................
O69205_ACTPA/8-112AVVTVASDVVR.GVPVLRVAGE.IDA-NVAD-E-VRRALLP--WL--------DG--L......................
P73609_SYNY3/4-107NIESEIINNA....AKLTLIGE.LDG-GTAP-L-FKEKIEE--VA--------QA--E......................
SP2AA_LYSSH/4-107QLEMVTRETV.....VIRLFGE.LDH-HAVE-Q-IRAKISA--AI--------FQ--GT.....................
O84431_CHLTR/3-107NFQKEEQGQT....GILHLQGK.LDG-VSSP-A-VQESISE--SL--------SN--G......................
P71568_MYCTU/15-120AIAVRTQDSV....VILTADGA.LDS-SSSA-L-LRDSLTR--AT--------LE--QP.....................
S26A1_RAT/529-685AAEFEGLLPPP.EVRVFRFTGP.LYY-ANKD-F-FLRSLYS--LT--------GL--DAGYSATRKDRGTE.........
P73607_SYNY3/2-105DIQINQQEDI....TVVTLSGE.VDA-NTAP-K-IHEVILP--LA--------EP--G......................
SP2AA_BACME/4-109SIELEFKQDV....LLVRLTGE.LDH-HTAE-E-LRSKITE--AI--------EK--ES.....................
YVDB_BACSU/421-528VLAKREDPSV....SMYAIEGP.LFF-GSID-S-LESSLLE--HV--------QK--KP.....................
RSBV_LISMO/4-109SIEIKERDTD...HIDIFVAGE.IDA-YTAP-K-VKEALEV--YQ--------VK--EG.....................
Q46665_ECOLX/332-437PVVVDVPDDV....LVLRVIGP.LFF-AAAE-G-LFTDLES--RL--------EG--K......................
S26A4_HUMAN/536-725YKNIEEPQGV....KILRFSSP.IFY-GNVD-G-FKKCIKS--TV--------GF--DAIRVYNKRLKALRKIQKLIKSG
RSBV_BACLI/4-107AVDTKKNDHV....IEVKVAGE.IDV-HTAP-A-LRDELMP--LA--------EE--G......................
O83261_TREPA/17-124KMNLQKIDDLE.GGVVVFLNGY.IDT-YNSS-F-FQKRIAK--VI--------DA--G......................
Y1364_MYCTU/550-649FVSLVESGRI.......VVRGD.VDS-TTAA-T-LDRQIAV--ES--------RS--GI.....................
O67306_AQUAE/448-564NAEKRGLPECP.QIMFIRPNMS.IYF-GNAQ-Y-VYDYIMN--KV--------ED--ALFN...................
Q9Z6Z7_CHLPN/2-106NLSAKEYGDI....IVIYLQGS.LDA-VSVP-S-VQEYLEQ--FI--------QK--K......................
SUT31_ARATH/514-633YPSSRTVPGI....LILEIDAP.IYF-ANAS-Y-LRERIIR--WI--------DE--EEERVK.................
Q9Z6P5_CHLPN/441-545KAEVPQNTEI......YEINGP.FFF-GIAD-R-LKNLLND--IE--------KP--P......................
O17951_CAEEL/537-690YQETIFYKGI....CIFKFDAP.LLF-HNVE-C-FKKCIEK--VY--------DE--WKKSSEFNFVKEPNA........
O69655_MYCTU/6-111SITVTVADHNG..VAVLSIGGE.IDL-ITAA-A-LEEAIGE--VV--------AD--N......................
SP2AA_BACLI/4-109GIDIHVKESV....LCIRLTGE.LDH-HTAE-T-LRKQVSG--HL--------EQ--TD.....................
Q55415_SYNY3/433-538RWLDEGNGRV....LLFQLSGP.MIF-GVAK-A-IAREHNA--IQ--------EC--.......................
SULH1_SCHPO/592-725NPNLTVRDPPA.GVLIFRLQES.FTY-PNAG-H-VNSMLTS--KA--------KT--VTRRGNANIYKKA..........
O07728_MYCTU/29-135RAVTECTGSA....VVVHVGGD.IDA-SNEV-A-WQRLVSK--SA--------AI--AI.....................
P72770_SYNY3/438-545HPENLVISGV....LIYRINGP.ILY-FNIN-N-IESDLFN--HL--------AQ--QQE....................
Q9Z841_CHLPN/3-107DIQKEEHGST....TIFHLHGK.LDG-ISSP-E-VQENISQ--SL--------AA--G......................
O07488_YEREN/391-488TSVLEGTSRT......YTVTGQ.VFF-ASAD-R-FTSHFDF--RE--------AI--E......................
SUT33_ARATH/498-617YKEAQRIPGF....LVLSIESP.VNF-ANSN-Y-LTERTSR--WI--------EE--CEEEEA.................
P73474_SYNY3/396-498DRVLTEDENH....RIYNVSGQ.IFF-VSKE-E-FLEAFDF--DE--------LV--D......................
SP2AA_GEOSE/4-109AIDLEVKQDE....LIVRLSGE.LDH-HTAE-N-CMNKCRM--CL--------EK--RA.....................
S26A3_HUMAN/526-716YYDMYEPEGV....KIFRCPSP.IYF-ANIG-F-FRRKLID--AV--------GF--SPLRILRKRNKALRKIRKLQKQG
SUT41_ARATH/519-638YPEAYTYNGI....VIVRIDSP.IYF-ANIS-Y-IKDRLRE--YE--------VA--VDKYTN.................
O84770_CHLTR/2-106EWIAREYKNI....FIVSLKGD.MDA-VTVP-A-LEEFLTK--SI--------AK--GR.....................
Y1365_MYCTU/18-124KATIQHHDSA....VIIHARGE.IDA-ANEH-T-WQDLVTK--AA--------AA--TT.....................
RSBRB_BACSU/147-272EMNAKQQLNAQ.REMILELSSP.VIT-LSKS-T-ALLPLVG--DI--------DT--ERAKFILE...............
SUT1_STYHA/538-656YPKAAQIPGM....LIIRVDSA.IYF-SNSN-Y-IKERILR--WL--------ID--EGAQRT.................
SP2AA_BACCO/4-109AIDLEVKKDV....LCIRLQGE.LDH-HTAE-S-LRASVTK--AI--------EE--NG.....................
Y1739_MYCTU/443-553YPQAKRVPGL....VVYRYDAP.LCF-ANAE-D-FRRRALT--VV--------DQ--DPGQVE.................
P71937_MYCTU/31-137RATTDGSGAA....LLIHAGGE.IDG-RNEH-L-WRQLVTE--AA--------AG--VT.....................
SP2AA_PAEPO/4-109QIEMEHHRGV....LIVRLSGE.LDH-HTSD-M-VRMQMDE--AI--------QR--RQ.....................
SULX_YEAST/572-707SLDVEGTEEIE.GCMIVRIPEP.LTF-TNSE-D-LKQRLDR--IE--------RY--GSSKIHP................
SUT21_ARATH/548-668YPMTVKTPGV....LIFRVKSA.LLC-FANA-S-SIEERIM--GW--------VD--EEEEEEN................
O83249_TREPA/5-107NIAKDVRPGC....VLLTVTGA.VSS-YTYG-E-FESRVHG--AL--------KE--.......................
PHOT_BACSU/148-254TPIVPIRNGI....SALPLVGN.LTE-ERFN-S-IVCTLTN--IL--------ST--SK.....................
RSBS_BACSU/5-111KIPILKLYNC....LLVSIQWE.LDD-QTAL-T-FQEDLLN--KI--------YE--TG.....................
O33206_MYCTU/385-486RKAKVTQDDT....GTYRIDGP.LSF-LSVD-G-VFGSLRD--GR--------E.--.......................
RSBRA_BACSU/151-261APLIPVFENI....TVMPLVGT.IDT-ERAK-R-IMENLLN--GV--------VK--HR.....................
SUT11_ARATH/518-636YPDAAQIPGI....LIIRVDSA.IYF-SNSN-Y-VRERASR--WV--------RE--EQENAK.................
Y1081_THENE/1-106MFPYKIVEDV....VILMPNKE.LNI-ENAH-L-FKKWVFD--EF--------LN--KG.....................
SUT3_STYHA/511-631YPMAVTTPGI....LVIRISSG.SLC-FANA-G-FVRERIL--KW--------VE--DEEQDNI................
SULH3_SCHPO/533-653STAVESAPRI....LVVRIPEP.LFF-ANVS-Q-LEDRLNR--LE--------KY--GHPRMHP................
YG35_YEAST/657-777YVQTKFLDGIGEQIYVLKLQNL.LFF-GTII-S-IEEKIER--LL--------QI--SNKDA..................
O33361_MYCTU/29-135QIRAYLHHLA....TVVTIRGE.IDA-ANVE-Q-ISEHVRR--FS--------LG--T......................
O83551_TREPA/4-108ELKVRQSGGI....CVVDISGD.MDL-YHSY-K-LKDLVLK--LF--------DR--G......................
P73108_SYNY3/3-107SFNPQIVTRD.....VFYPQGT.LSA-AVTQ-A-FQADLAS--WL--------AT--TS.....................
RSBRC_BACSU/163-272ELSAPVIVLFH.SVGLLPLIGD.IDT-VRAK-L-IMENTLH--QC--------AK--KK.....................
Q40008_HORVU/530-648YPEATKVPGV....MIVRVDSA.IYF-TNSN-Y-VKERILR--WL--------RD--EEEQQQ.................

PF13466

Q310Z9_DESDG/492-572----------------LQLAGD-ITI.ERSA.Q.LQEAFQE..AL........SR..Y----------------------
B5HV30_9ACTO/31-112----------------LVLAGP-VTR.DEVT.E.LGDEVRA..LLR.....TTGA..G----------------------
O33552_RHOSH/4-82----------------LTLSGT-LRL.QDAP.G.LIERLAA..AL........AA..G----------------------
A4WP58_RHOS5/4-82----------------LKLSGN-LRL.QDAP.G.LIERLEA..AL........AT..G----------------------
A9BX84_DELAS/2-83----------------LQLPRE-LTY.RQAR.S.CLVQLRP..QV........QAFDG----------------------
Q0K681_CUPNH/47-125----------------LSLGTS-LTN.QNAA.A.VLRDGLA..RL........AQ..G----------------------
B5H529_STRPR/9-95----------------MHITGR-ITP.ADVP.R.LCEELRH..LLRDDGTGGGA...P----------------------
Q0RDC2_FRAAA/24-104----------------VRLVGR-VDV.RTVG.T.LRSLLHA..AI........DN..G----------------------
D1AD83_THECD/187-267----------------LALSGE-LDA.ARHA.V.FGEALSQ..ALA......RAN..G----------------------
D2SCD5_GEOOG/29-109----------------ITAAGE-LDR.AVAH.R.LSDALDA..LA........LT..G----------------------
A1VK31_POLNA/2-82----------------LKLPAV-LTH.AVAS.G.FFHTVAK..EVL......SLP..K----------------------
A8ZVX1_DESOH/4-85----------------IVLHGD-CLV.NRAE.E.LHQLFCH..LL........KQ..S----------------------
Q3SFW3_THIDA/281-359----------------VRLSGE-ITP.ADDS.A.LQQLSAH..AA........NH..N----------------------
B9TGW9_RICCO/228-309----------------LSVSGV-LDF.ETTV.Q.LLAQGRE..WIE......SAA..P----------------------
A6F4X4_9ALTE/15-95----------------LSVSGV-IDP.LTVV.S.VRQEGEK..WI........RA..S----------------------
A1W422_ACISJ/2-83----------------LVLPAE-LTH.RHAG.A.TLRMLLQ..GL........KA..Q----------------------
A1U461_MARAV/15-95----------------LCVTGD-VDA.DTVL.A.LRKQGEQ..EIR......QAD..G----------------------
Q1N2W9_9GAMM/6-85----------------LDLGEK-CTI.VIAE.D.LHQTLET..MV........ES..G----------------------
A3JK96_9ALTE/17-97----------------LTIDGQ-ADA.MAAA.D.LRQRGEA..LLA......GAK..G----------------------
Q21UA2_RHOFD/4-85----------------LVLPQE-LTQ.RQAT.V.CLRALVQ..DLA......SLP..G----------------------
A3KIB8_STRAM/157-235----------------LRVAGS-VDH.RTTH.A.LAAALDA..AL.......TWP..G----------------------
Q2P1Y1_XANOM/4-83----------------VTLGED-LGI.ETSA.D.LKQKLAG..FL........TQ..G----------------------
B1Y2Z1_LEPCP/2-84----------------LSLPER-LTHVETPP.T.LRSLFAEMDAL........PA..G----------------------
Q8EEQ5_SHEON/14-91----------------VNLTEE-LTI.YSVM.E.FRDALVG..HL........QP..G----------------------
D2S5L7_GEOOG/30-110----------------VDLAGH-LDR.RTVH.L.LHDAIST..LL.......LTD..G----------------------
A7MNS4_CROS8/14-91----------------LRLNGT-LDR.ETLT.P.LWEQRQ...SI........TD..G----------------------
Q2SFX7_HAHCH/14-84----------------LTLNGE-LTI.YCAA.E.AKAPLL.............EH..K----------------------
A7MSC9_VIBHB/15-94----------------LKLTGA-LDR.DSVP.A.LWAVAQQ..WL........PS..Q----------------------
B9JTP2_AGRVS/23-100----------------LKLASV-LDL.NEAS.Q.LKDKLLS...M........RG..G----------------------
A6E679_9RHOB/5-84----------------LPLTGD-LKI.AAAD.D.LAKQLST..AL........IS..G----------------------
B8DPA7_DESVM/571-651----------------LVLSGE-VTI.ERGA.D.LREALLD..VL........GS..F----------------------
C6C1P3_DESAD/15-93----------------MNISGR-LDA.EGAG.E.VWDKARA..AV........AA..G----------------------
E3I167_RHOVT/14-94----------------LELEGD-LRP.RDAS.A.LHEALLV..AL........SG..E----------------------
B4VGC8_9ACTO/25-99----------------VAARGE-LDQ.DTLG.P.LEEALAS..AA........DR..H----------------------
E3IYM7_FRASU/24-104----------------IELAGE-LDA.PGRR.C.LRDQIAE..LL........GR..G----------------------
C1D624_LARHH/5-83----------------LALPSA-VTF.DEVS.G.LLRNWLP..AV........RA..A----------------------
A4YXB4_BRASO/320-399----------------LSLSGP-ADA.RHVD.R.AIPVFRS..AV........AV..R----------------------
B8L741_9GAMM/14-91----------------LRLRGV-LDR.AAVI.A.LWPQLQ...AL........PA..Q----------------------
D1C014_XYLCX/37-113----------------IVLSGE-IDA.DIGA.E.LSEMSAE..AE........AT..G----------------------
C6WD00_ACTMD/919-1001----------------LHLGGD-LDL.DGVR.A.LREFLLG..RVD......VAD..R----------------------
A9CYE8_9RHIZ/11-88----------------LKLPEV-LDL.NAAS.R.LHEQVLA..H..........K..G----------------------
E3J1T6_FRASU/56-136----------------LSIDGD-IDA.SVLP.A.LVGTLAK..VA........HH..G----------------------
C6WQ84_ACTMD/60-139----------------LHVAGE-IDQ.LSAP.V.LRGALDL..AL........KH..R----------------------
Q2SPQ4_HAHCH/13-91----------------IKLPGA-FSI.SSVE.K.VYEQVNN..AP........AT..Q----------------------
D0FND2_ERWPE/14-91----------------LRLIGE-LER.ETLL.P.LWQQREA..VM........ER..V----------------------
D2SFP4_GEOOG/531-612----------------VRATGA-VDM.LGAE.Q.MRIRLLE..ASH......GGT..G----------------------
D2B5R7_STRRD/72-150----------------LKVSGD-IDR.TTRR.L.WEEALDG..LV........TQ..G----------------------
B8DLB2_DESVM/179-259----------------VRIRGT-VNS.PAEP.V.LRHVFEE..AL........LT..G----------------------
A6D4D8_9VIBR/13-92----------------LELIGN-VDR.DTVP.E.LWNTIQS..VN.......FDE..P----------------------
A3PIP6_RHOS1/5-82----------------LDLPAR-LDH.QGAR.Q.LYAALLS...M........PP..G----------------------
A3WPY6_9GAMM/16-94----------------LSLAGS-LTR.SAIP.A.QWNALSQ..LL........NE..K----------------------
D0SFB4_ACIJO/9-88----------------MQLSGQ-ITY.DNAE.S.YYQQGLK..VI........QS..Q----------------------
D4DRH6_NEIEG/1-77----------------MHLDGE-ITV.KTVH.G.SAYRQFV..QL........SG..G----------------------
D0KEM1_PECWW/14-90----------------LALIGD-LDR.ETLL.P.FWQQRES..LL........AE..K----------------------
D0KYU0_HALNC/26-108----------------VRVQGD-LLR.SSIE.S.LSDLSLP..MPD.....GQTP..G----------------------
D4F180_EDWTA/15-90----------------LRLHGE-LVC.DALG.E.FWRQRQ...AL........FQ..G----------------------
D5X3Z8_THIK1/566-644----------------LHLSGE-I.L.GSSS.D.FLNPLEQ..AA........KT..H----------------------
B9J943_AGRRK/10-87----------------VSLAAV-LDL.NEAS.A.LRGKLMG..L.........RG..S----------------------
C3JRM8_RHOER/87-163----------------LRLAGE-LDM.GQRV.E.LVHALDR..LL........LV..G----------------------
C6NT90_9GAMM/20-97----------------LRLSGD-WRL.DALD.EALRSEELR..SL........AV..D----------------------
B1W2W2_STRGG/20-107----------------LTVTGR-VSR.AVVA.D.LCVELER..ALADPGGAAPAP..G----------------------
B9XQZ5_9BACT/43-124----------------LRLSGR-LDA.DSTP.F.LWQRLQS..ALV......VPP..G----------------------
B4UM51_ANASK/12-87----------------IRMDGV-LDV.PTAR.R.LAAQLAI..AP........AG..S----------------------
A1SBD9_SHEAM/6-85----------------VELGSE-LTI.RNIQ.P.IYSQLAD..LL........HQ..G----------------------
A0LC67_MAGSM/14-94----------------ISLVGS-FSH.AIFK.E.FKNAYLP..LT........PG..P----------------------
C7D676_9RHOB/11-91----------------LALPPV-VDL.RNAD.A.TWKASQQ..LC........DE..N----------------------
A4YMN9_BRASO/16-97----------------VVVRGA-LTS.DTQT.A.FKQQVEP..VL........SN..P----------------------
C7LTF6_DESBD/15-91----------------IKLSGN-LTL.DHSR.D.IHAELLA..RL........PQ..A----------------------
B1LTK1_METRJ/26-107----------------LALDGR-WTA.DQAP.T.VEAAAAR..IA........AA..G----------------------
B0U4D0_XYLFM/14-94----------------LVLSGP-LNR.DAAI.R.LWSEIQV..QS........KS..N----------------------
Q0RZA3_RHOSR/48-126----------------LRVSGD-LDM.VTAP.I.LAACLDE..VV........LR..G----------------------
C5BID3_TERTT/281-360----------------LTLTGA-MGS.DFSR.N.LMAEVVD..HA........RP..H----------------------
D0W2G3_NEICI/10-87----------------LRVSGD-ITV.KTLTGE.AFERFQQ..QC.......RLN..G----------------------
Q58IT2_9ACTO/27-106----------------LVLAGQ-IGA.ETLR.E.LEERLAT..PPL......REA..T----------------------
Q2SBJ1_HAHCH/18-100----------------LSISGI-VDL.SNVA.D.LLAEGEK..AV........QA..A----------------------
B4D414_9BACT/18-99----------------VRVEGK-GSF.LNST.G.LKEFAKE..MI........NR..G----------------------
D5VNV2_CAUST/4-81----------------IALPEN-LDL.KAAV.P.LKAALLA..R..........R..G----------------------
B5HHQ5_STRPR/28-107----------------LVFSGV-LDA.HALP.E.LEERLLD.PRL.......RQA..G----------------------
Q1QXI2_CHRSD/17-99----------------LKLSGD-VRL.TLCA.T.LDQQAQR..VA.......DSP..G----------------------
Q12BT3_POLSJ/427-501----------------LALRGR-ATW.MHCD.A.FYETARA..VL........EE..G----------------------
C6E422_GEOSM/12-96----------------VTVQGS-CSR.EEAA.V.LHQALVC..RLNEL..VERKT..E----------------------
C9R4W7_AGGAD/20-98----------------LRLKGE-LSQ.NTLL.P.LWQQRAS..FLL.....ARKT..E----------------------
D9T369_MICAI/189-267----------------VALAGE-LDP.SNHR.D.FAAALER..ADP.....RPVA..G----------------------
Q31HM4_THICR/6-86----------------IELPEN-LTI.HHIE.E.EFGNLKI..AF........QS..D----------------------
C4RJ05_9ACTO/208-288----------------LRLTGE-ADY.SSGQ.A.VAATVEA..LV........DQ..H----------------------
Q31GZ5_THICR/18-93----------------IKLSGQ-INM.DAVA.S.FYAQGIK..SL........VN..P----------------------
A7H922_ANADF/18-92----------------IRLSGV-FDH.ASAA.E.LAQRLQQ..E.........AA..T----------------------
Q21SV7_RHOFD/514-592----------------VELSGE-VLG.DAAE.A.LDKLQAG..LY........DA..K----------------------
B0BQM2_ACTPJ/20-100----------------VKLSGE-LTR.DTLL.P.LWRQRAS..FL.......SPK..G----------------------

PF01740

SUT22_ARATH/540-662...............EVLK......................................ENGLQVV-ILDMSCV..MGVDTS
RSBRD_BACSU/161-267............................................................LSYL-FLDISGV..PIVDTM
S26A2_HUMAN/569-715..........RKIKEKVV.TLGGIQDE......................MSVQLSHDPLELHTI-VIDCSAI..QFLDTA
O45016_CAEEL/553-725....EKEEEDAEIPKETE.KETKLEVTTHQAKV.........LDEKHAEPEPNPADQYERLTHI-IIDCSTI..IYVDLM
SULP3_CAEEL/546-696.........QMNSDRSAD.IFDSKLKSA....................RRRWKRDQKSENRCKL-VIDCDGF..PYVDYL
O85703_STRLI/11-115.............................................................ARV-VLDLDGI..EFFDCS
O04001_SPOST/529-651........................................................KQTELRFV-ILDLSAV..PAIDTS
SUT32_ARATH/505-623.................T.S....................................GDISLQYI-VLDMSAV..GNIDTS
Q55814_SYNY3/440-540.............................................................DVL-ILDLATV..PRLGVT
RSBV_BACSU/4-107.............................................................ADL-RICLKDV..SYMDST
O69205_ACTPA/8-112............................................................RGPG-VLDLTGV..RFMAST
P73609_SYNY3/4-107............................................................ISKL-VLMMDQL..EYMSSA
SP2AA_LYSSH/4-107............................................................VTTI-IWNLEGL..SFMDSS
O84431_CHLTR/3-107............................................................MKNI-ILDCGDL..DYISSA
P71568_MYCTU/15-120.............................................................SAV-IVNVTEL..QVAEES
S26A1_RAT/529-685.........VGVSNRSLV.DRKDLGSVS....................SGDGLVVPLAFGFHTV-VIDCAPL..LFLDVA
P73607_SYNY3/2-105.............................................................SKI-LLDMTAV..PYMSSA
SP2AA_BACME/4-109............................................................ISHL-ILNLQHL..TFMDSS
YVDB_BACSU/421-528.............................................................KTL-ILLMNKV..HYMDTS
RSBV_LISMO/4-109.............................................................IVL-RIDLTEV..SYMDST
Q46665_ECOLX/332-437.............................................................RIV-ILKWDAV..PVLDAG
S26A4_HUMAN/536-725QLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTK.EIEIQVDWNSELPVKVNVPKVPIHSL-VLDCGAI..SFLDVV
RSBV_BACLI/4-107.............................................................KDL-KVSLKDV..SYMDST
O83261_TREPA/17-124............................................................YTRI-VFNCASL..NYVSST
Y1364_MYCTU/550-649.............................................................APV-TIDLSAV..THLGSA
O67306_AQUAE/448-564.........................................................GRPLKFV-LIDMEAV..NYVDAT
Q9Z6Z7_CHLPN/2-106............................................................HLKI-ALNFTDV..SYISSA
SUT31_ARATH/514-633.................Q.S....................................GESSLQYI-ILDMSAV..GNIDTS
Q9Z6P5_CHLPN/441-545.............................................................KIF-ILCMTRV..PTIDAS
O17951_CAEEL/537-690.........GKGSKFTFE.GMHRIAPITE..................IPLHPGINRDPILPRHF-VIDCSGF..TFIDLM
O69655_MYCTU/6-111............................................................PTAL-VIDLSAV..EFLGSV
SP2AA_BACLI/4-109............................................................IRHI-VMNLADL..SFMDSS
Q55415_SYNY3/433-538.............................................................AAI-VFDLSDV..PHLGVT
SULH1_SCHPO/592-725...........SDRPWND.PAPRKKK.......................NAPEVEDTRPLLRAI-ILDFSAV..NHIDTT
O07728_MYCTU/29-135...........................................................APGPF-VIDIRDL..DFMGSC
P72770_SYNY3/438-545...........................................................PVELV-IFEMGTS..PGIDTP
Q9Z841_CHLPN/3-107............................................................SKNI-ILDCAHL..DYMSSA
O07488_YEREN/391-488..............................................................NV-VIDVSHA..HFWDIT
SUT33_ARATH/498-617.................Q.E....................................KHSSLQFL-ILEMSAV..SGVDTN
P73474_SYNY3/396-498..............................................................RV-TIDLTHA..HLWDQG
SP2AA_GEOSE/4-109............................................................IRHI-VLNLGQL..TFMDSS
S26A3_HUMAN/526-716LLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSL-ILDFSAV..SFLDVS
SUT41_ARATH/519-638.................R.G...................................LEVDRINFV-ILEMSPV..THIDSS
O84770_CHLTR/2-106.............................................................VNV-LLNMEKV..FYMSSA
Y1365_MYCTU/18-124...........................................................APEPL-VVNLNGL..DFMGCC
RSBRB_BACSU/147-272................NT.LQ.................................ACAKRRVEHL-LIDLSGV..VVVDTM
SUT1_STYHA/538-656.................E.S....................................ELPEIQHL-ITEMSPV..PDIDTS
SP2AA_BACCO/4-109............................................................IRHL-VLNLEQL..SFMDSS
Y1739_MYCTU/443-553.................W.F....................................VLNAESNV-EVDLTAL..DALD..
P71937_MYCTU/31-137...........................................................APGPL-IVDVTGL..DFMGCC
SP2AA_PAEPO/4-109............................................................CEHI-VLSLKNL..QFMDSS
SULX_YEAST/572-707................GR.KS.................................LRSKDSIKYV-IFDLGGM..TSIDSS
SUT21_ARATH/548-668.................T.KS..................................NAKRKILFV-VLDMSSL..INVDTS
O83249_TREPA/5-107.............................................................NHV-VLDLSGV..TAMSSS
PHOT_BACSU/148-254...........................................................D.DYL-IIDLSGL..AQVNEQ
RSBS_BACSU/5-111............................................................ANGV-VIDLTSV..DMIDSF
O33206_MYCTU/385-486..............................................................DV-SLDLQHV..TYLDTS
RSBRA_BACSU/151-261............................................................SQVV-LIDITGV..PVVDTM
SUT11_ARATH/518-636.................E.Y....................................GMPAIRFV-IIEMSPV..TDIDTS
Y1081_THENE/1-106............................................................YNKI-LLVLSDV..ESIDSF
SUT3_STYHA/511-631.................E.E...................................AAKGRVQAI-IIDMTDL..TNVDTS
SULH3_SCHPO/533-653................GE.TP.................................YRRIEDIEVV-VFDMVGV..SSIDSS
YG35_YEAST/657-777........................................................TKRRIKYL-ILDFKNINADNIDYS
O33361_MYCTU/29-135.............................................................NPM-VLDLSEL..SHFSGA
O83551_TREPA/4-108............................................................PRCI-VIDLEAV..EYIDSS
P73108_SYNY3/3-107............................................................SPVM-VIDFSQV..DFLDSA
RSBRC_BACSU/163-272............................................................VTQL-YIDLSGV..AVIDTM
Q40008_HORVU/530-648.................E.Q....................................KLSKTEFL-IVELSPV..TDIDTS

PF13466

Q310Z9_DESDG/492-572---------------------------------------------------------....EVL.RIDSQQL--ESADLT
B5HV30_9ACTO/31-112---------------------------------------------------------.....VV.VCDVAGL--GPPGLG
O33552_RHOSH/4-82---------------------------------------------------------.....DV.EIDASGV--LAVDAA
A4WP58_RHOS5/4-82---------------------------------------------------------.....DV.EVDASEL--AGADAA
A9BX84_DELAS/2-83---------------------------------------------------------....AQV.RVDASGV--EVFDSA
Q0K681_CUPNH/47-125---------------------------------------------------------.....EV.QVDCTGL--AQVDSS
B5H529_STRPR/9-95---------------------------------------------------------....CEV.FCDVGGL--AQVNLA
Q0RDC2_FRAAA/24-104---------------------------------------------------------...SGPL.RVDVAGL--ELGDHA
D1AD83_THECD/187-267---------------------------------------------------------....SPV.HVDMAEL--KFIDVG
D2SCD5_GEOOG/29-109---------------------------------------------------------...HRTW.TVDTSGI--TFCDAE
A1VK31_POLNA/2-82---------------------------------------------------------.....EV.VVDASAL--SQFDSS
A8ZVX1_DESOH/4-85---------------------------------------------------------...DDQV.AVDMSAV--GRCDVS
Q3SFW3_THIDA/281-359---------------------------------------------------------.....EV.LVDLSEV--ARVDYG
B9TGW9_RICCO/228-309---------------------------------------------------------....AQF.TIDLSRV--EYSSSA
A6F4X4_9ALTE/15-95---------------------------------------------------------...KTDL.QVDLSAM--GTAHSV
A1W422_ACISJ/2-83---------------------------------------------------------D..ESLV.VVDAGAL--TAFDSS
A1U461_MARAV/15-95---------------------------------------------------------.....TL.EVDLSGL--GTAHSV
Q1N2W9_9GAMM/6-85---------------------------------------------------------....QPV.QIDGSKL--EQVDTA
A3JK96_9ALTE/17-97---------------------------------------------------------.....DI.TVDLAKL--TSASSS
Q21UA2_RHOFD/4-85---------------------------------------------------------....PEA.VVDASPL--NRFDSS
A3KIB8_STRAM/157-235---------------------------------------------------------.....DI.RVDMTEL--EFIDLA
Q2P1Y1_XANOM/4-83---------------------------------------------------------....GDL.VLDAGEV--RRIHTA
B1Y2Z1_LEPCP/2-84---------------------------------------------------------....TSV.VIDGHQL--GRFDSS
Q8EEQ5_SHEON/14-91---------------------------------------------------------....VDI.SVDLSQV--TEVDTA
D2S5L7_GEOOG/30-110---------------------------------------------------------....DTW.VVDASHV--TACDPA
A7MNS4_CROS8/14-91---------------------------------------------------------.....LQ.RIDLSGL--ERVDTA
Q2SFX7_HAHCH/14-84---------------------------------------------------------.....DI.DIDLSQL--TELDGA
A7MSC9_VIBHB/15-94---------------------------------------------------------....TEL.ECSLEEI--ERIDSA
B9JTP2_AGRVS/23-100---------------------------------------------------------.....AI.EIDASGV--ERMGAL
A6E679_9RHOB/5-84---------------------------------------------------------.....DV.TLCTKKL--VSIDAA
B8DPA7_DESVM/571-651---------------------------------------------------------....ATV.RIDLSGV--TAADLT
C6C1P3_DESAD/15-93---------------------------------------------------------.....CL.VVECSGI--EYLDGG
E3I167_RHOVT/14-94---------------------------------------------------------....DEI.LVDARRV--TSLDVS
B4VGC8_9ACTO/25-99---------------------------------------------------------....RLV.VLDASSI--TFGDSS
E3IYM7_FRASU/24-104---------------------------------------------------------...GATV.TVDVGGL--RRVDIP
C1D624_LARHH/5-83---------------------------------------------------------.....DC.RLDWAAV--RRVDSA
A4YXB4_BRASO/320-399---------------------------------------------------------....KHV.RLDFSNV--CAIDAR
B8L741_9GAMM/14-91---------------------------------------------------------.....LA.RLELGEV--ERVDSA
D1C014_XYLCX/37-113---------------------------------------------------------....LPV.EIDAHHI--TFMDSS
C6WD00_ACTMD/919-1001---------------------------------------------------------....RPV.ELDLSGL--GYLSSS
A9CYE8_9RHIZ/11-88---------------------------------------------------------....ESI.DVDASDV--SRLGAQ
E3J1T6_FRASU/56-136---------------------------------------------------------...RGDV.RVDLGRL--RRVDVG
C6WQ84_ACTMD/60-139---------------------------------------------------------...PPVL.VVDLGEV--RLLAVA
Q2SPQ4_HAHCH/13-91---------------------------------------------------------.....RI.KFDGAEV--EVMDAA
D0FND2_ERWPE/14-91---------------------------------------------------------......E.TIDVSAL--ERVDSG
D2SFP4_GEOOG/531-612---------------------------------------------------------.....RV.ELDLTEV--TLFSSA
D2B5R7_STRRD/72-150---------------------------------------------------------....DDM.HIDLAGL--TFVDVR
B8DLB2_DESVM/179-259---------------------------------------------------------...APTV.VLDFEPS--VSVNGA
A6D4D8_9VIBR/13-92---------------------------------------------------------.....EM.ELALDKV--KRFDSA
A3PIP6_RHOS1/5-82---------------------------------------------------------.....DT.CLAAGQV--SFVGGL
A3WPY6_9GAMM/16-94---------------------------------------------------------.....TVKQVDVAEV--TLIDTA
D0SFB4_ACIJO/9-88---------------------------------------------------------...SYPV.VVNLAQL--EHGSTL
D4DRH6_NEIEG/1-77---------------------------------------------------------.....DIKAVDLSAV--SRADSA
D0KEM1_PECWW/14-90---------------------------------------------------------......T.TLDVSGL--NRVDSA
D0KYU0_HALNC/26-108---------------------------------------------------------....TRL.EIALGSV--GRIDTA
D4F180_EDWTA/15-90---------------------------------------------------------.....IN.CLDISGV--TRVDSA
D5X3Z8_THIK1/566-644---------------------------------------------------------....EQM.SISLRQL--RRIDFS
B9J943_AGRRK/10-87---------------------------------------------------------.....NV.AIDASSV--ERIGAL
C3JRM8_RHOER/87-163---------------------------------------------------------....TDI.HVDLSGV--TFMSSG
C6NT90_9GAMM/20-97---------------------------------------------------------.....RV.RL..DDV--DAADSA
B1W2W2_STRGG/20-107---------------------------------------------------------....AAV.DCDVGGV--TRPDLT
B9XQZ5_9BACT/43-124---------------------------------------------------------....ATL.EVNVAPL--TYSDSA
B4UM51_ANASK/12-87---------------------------------------------------------.....LV.RIDLTHV--RELHDF
A1SBD9_SHEAM/6-85---------------------------------------------------------....RPV.TLNAARL--IKADTA
A0LC67_MAGSM/14-94---------------------------------------------------------...SFRY.CIDLSQV--KSLDSS
C7D676_9RHOB/11-91---------------------------------------------------------...AAQL.TLDASDL--AEVTSI
A4YMN9_BRASO/16-97---------------------------------------------------------S..VSKI.KLDFSGL--QSIEAA
C7LTF6_DESBD/15-91---------------------------------------------------------....SAI.TLDLADS--EKSDLS
B1LTK1_METRJ/26-107---------------------------------------------------------R..AGPV.AVDLSGI--ERLDTL
B0U4D0_XYLFM/14-94---------------------------------------------------------....GVC.QLDLTGV--EQLDSA
Q0RZA3_RHOSR/48-126---------------------------------------------------------....RCA.VVDLLPA--GFVGCA
C5BID3_TERTT/281-360---------------------------------------------------------....KPL.QLDLSGL--EYMDNS
D0W2G3_NEICI/10-87---------------------------------------------------------.....IV.AVDFSGV--NRADSA
Q58IT2_9ACTO/27-106---------------------------------------------------------.....EW.LVNMSQV--TRFDLA
Q2SBJ1_HAHCH/18-100---------------------------------------------------------D.ATSPL.RIDVSLV--ENAQSV
B4D414_9BACT/18-99---------------------------------------------------------...FREF.AVDLKNC--TVMDST
D5VNV2_CAUST/4-81---------------------------------------------------------....API.EIEADQV--RRFGGL
B5HHQ5_STRPR/28-107---------------------------------------------------------.....DR.VLDMSGL--ERIELA
Q1QXI2_CHRSD/17-99---------------------------------------------------------...LAAV.MIDLREA--TNVDST
Q12BT3_POLSJ/427-501---------------------------------------------------------....RPL.VLDLSGC--DYLDST
C6E422_GEOSM/12-96---------------------------------------------------------.....QV.ELDLCQV--DQIDAC
C9R4W7_AGGAD/20-98---------------------------------------------------------...TLDV.HWDLSQV--NRIDSA
D9T369_MICAI/189-267---------------------------------------------------------.....RV.VFDAAEL--RFVDHR
Q31HM4_THICR/6-86---------------------------------------------------------...AETY.KLVAGNV--ESIDTS
C4RJ05_9ACTO/208-288---------------------------------------------------------PDPATPI.HVDLAGL--RFADAT
Q31GZ5_THICR/18-93---------------------------------------------------------.....IE.VIDCSNV--KEADSS
A7H922_ANADF/18-92---------------------------------------------------------.....EV.VLDFSLV--REFADL
Q21SV7_RHOFD/514-592---------------------------------------------------------.....HL.VISCSRL--IRVDFS
B0BQM2_ACTPJ/20-100---------------------------------------------------------...NQHI.YWDLKDL--ERVDSA

PF01740

SUT22_ARATH/540-662GVFALEELHQELA.SND-IRLVI-AS-PRW-R-VL-HK.........LKRAKLD.EKIK.......TENIYMTVGEA
RSBRD_BACSU/161-267VAYQIFKVIDSTK.LLG-IETII-SG-IRP-E-IA-QT.........VVKLGLD.FSN.........VKTEQSLAKA
S26A2_HUMAN/569-715GIHTLKEVRRDYE.AIG-IQVLL-AQ-CNP-T-VR-DS.........LTNGEYC.KKEE.......ENLLFYSVYEA
O45016_CAEEL/553-725GQGALKDVYNDYK.TIG-ISVLF-AN-TNE-H-VR-QN.........FETSQFF.EEVP.......RGRMFVSVSDA
SULP3_CAEEL/546-696GLSTLKSVYVDLQ.AAG-IQCFF-VV-QKS-D-LK-KL.........FRATDFY.EVVD.......ESKVFNKVGDA
O85703_STRLI/11-115GLRLLYRARSQVL.DGG-GQVRL-VC-THA-M-TL-RM.........LRITGLA.RLL..........PPWPTLDEA
O04001_SPOST/529-651GVAFLIDIKKSIE.KRG-LELVL-VN-PTG-E-GH-GKNTASERGTQAFQVGIA.CIL..........TTGEAVASL
SUT32_ARATH/505-623GISMLEELNKILG.RRE-LKLVI-AN-PGA-E-VM-KK.........LSKSTFI.ESIG.......KERIYLTVAEA
Q55814_SYNY3/440-540ALLAIETMLKDAL.AKQ-REVFL-VG-AKG-Q-VQ-AR.........LQRLPVL.A............QLSPHHRLE
RSBV_BACSU/4-107GLGVFVGTFKMVK.KQG-GSLKL-EN-LSE-R-LI-RL.........FDITGLK.DII..........DISAKSEGG
O69205_ACTPA/8-112GLSLLVEAARRGR....-ARLVL-AT-AQR-G-VL-RP.........LQLTGMS.ALL..........PTHPTVDLA
P73609_SYNY3/4-107GLRILVFAKQKMG..SG-VEIFL-VG-TQE-M-VN-DT.........IEQTGLH.HSF..........HLVESYDFH
SP2AA_LYSSH/4-107GVGLVLGRMRELE.AVA-GRTIL-LN-PSP-T-MR-KV.........FQFSGLG.PWM...........MDATEEQA
O84431_CHLTR/3-107GIRVLLQSYHQVG.KNA-GKIAL-TS-VSK-T-VE-QT.........LYVTGFL.SYF..........KVFDSVNEA
P71568_MYCTU/15-120AWSVFISARWQADFRAD-VPVLL-VC-GHR-A-GR-AA.........VTRTGVA.RFM..........PVYPTEKAA
S26A1_RAT/529-685GMATLKDLRKNYR.ALD-ITLLL-AC-CSP-S-VR-DT.........LRKGGFL.GEDQG....TAEELLFPSVHSA
P73607_SYNY3/2-105GLRLLLYLYRQTT.ANS-AQLVL-VG-LSE-E-LI-DT.........MAVTGFL.DFF..........TTRPTLAEG
SP2AA_BACME/4-109GLGVILGRYKQVH.NNG-GEMVV-CA-ISP-A-IE-RL.........FNMSGLF.KII..........RFEPNEANA
YVDB_BACSU/421-528AEAVLGNIMNRIK.RHN-GKLMI-VG-LQS-Q-PK-EL.........LHKTGLF.HKIG.......KQHFFDHHDEI
RSBV_LISMO/4-109GLGVFVGAFKSLR.QRQ-SELVL-FG-LSD-R-LF-RL.........FEITGLS.DII..........EIKNVEGEM
Q46665_ECOLX/332-437GLDAFQRFVKRLP..EG-CELRV-CN-VEF-Q-PL-RT.........MARAGIQ.PIPG.......RLAFFPNRRAA
S26A4_HUMAN/536-725GVRSLRVIVKEFQ.RID-VNVYF-AS-LQD-Y-VI-EK.........LEQCGFF.DDNI......RKDTFFLTVHDA
RSBV_BACLI/4-107GLGVFVGIYKAVN.RTG-GSLVL-EN-LSE-R-LI-RL.........FDITGLK.DII..........DISGKSEGG
O83261_TREPA/17-124GIGSFTAFLKTVK.PKG-GDIVL-LD-IQP-R-VY-EV.........FQLLGFS.QFF..........NIRDSIADA
Y1364_MYCTU/550-649GVGALAAACDRAR.KQG-TECVL-VA-PPG-S-PA-HH........VLSLVQLP..............VVGADTEDI
O67306_AQUAE/448-564GAETIVRLVKDIK.QKG-VEVAF-AN-IGC-D-VY-PI.........LENAGFD.EVVN.......QDLVFNAKGEA
Q9Z6Z7_CHLPN/2-106GIRLLLSNFKLVQ.SLG-GKMCL-CC-VKE-S-VT-EV.........MRIAGLD.QLI..........LLCQSEQEC
SUT31_ARATH/514-633GISMMVEIKKVID.RRA-LKLVL-SN-PKG-E-VV-KK.........LTRSKFIGDHLG.......KEWMFLTVGEA
Q9Z6P5_CHLPN/441-545AMHALEEFFLECD.RQG-TLLLL-AG-VKK-T-PL-AD.........LKRYHLD.ELIG.......VDHIFSNIKSA
O17951_CAEEL/537-690GVSALKEVFSDLR.KKR-VQVYF-AS-TKV-P-VR-EM.........FEKCSFF.DFVS.......KENFYPTLRDA
O69655_MYCTU/6-111GLKILAATSEKIG..QS-VKFGV-VA-RGS-V-TR-RP.........IHLMGLD.KTF..........RLFSTLHDA
SP2AA_BACLI/4-109GLGVVLGRYKEIK.QLG-GEMIV-CA-ISP-A-VK-RL.........FDMSGLF.KII..........RLEQSEQRA
Q55415_SYNY3/433-538ASLALENAIEEAA.EKG-RAVYI-VG-ATG-Q-TK-RR.........LEKLQVF.RFVP.......ESNCYDDRSEA
SULH1_SCHPO/592-725GVQALVDTRKELE....-.....-IY-AGD-E-VE-FH.........FTDINND..............WIKRTLVAA
O07728_MYCTU/29-135AYAVLAQESVRCR.RRG-VNMRL-VS-NQP-I-VA-RT.........IAACGLR.RLI..........PLYATVETA
P72770_SYNY3/438-545AARWFKTLSQSLN.QQG-ITLKL-VN-ASG-F-VR-DR.........LRAEGLE.GEV..........GTFRRLDTV
Q9Z841_CHLPN/3-107GIRVLLQSYHQVG.QHS-GKIVL-TT-VPK-T-IE-QT.........LYVTGFL.SYF..........KIFNTVDEA
O07488_YEREN/391-488SVSALDKVVIKFR.REG-AGVEI-RG-MNE-A-TR-TI.........VDRFGVH.DKP.............EEVEKL
SUT33_ARATH/498-617GVSFFKELKKTTA.KKD-IELVF-VN-PLS-E-VV-EK.........LQRADEQ.KEFM......RPEFLFLTVAEA
P73474_SYNY3/396-498AVGTVEQIMTKFR.RNG-IDVEL-VG-LNG-A-SA-TL.........WQKLIKE.PEL..........KLINSSAEN
SP2AA_GEOSE/4-109GLGVILGRYKQIK.NVG-GQMVV-CA-VSP-A-VK-RL.........FDMSGLF.KII..........RVEADEQFA
S26A3_HUMAN/526-716SVRGLKSILQEFI.RIK-VDVYI-VG-TDD-D-FI-EK.........LNRYEFF.DGEV......KSSIFFLTIHDA
SUT41_ARATH/519-638AVEALKELYQEYK.TRD-IQLAI-SN-PNK-D-VH-LT.........IARSGMV.ELVG.......KEWFFVRVHDA
O84770_CHLTR/2-106GLRTLLSLAKLTQ.NHN-GKLCI-CC-LRD-E-VA-DI.........IRIAGLD.KVI..........TIRKAEQES
Y1365_MYCTU/18-124AVAVLAHEAERCR.RRG-VDVRL-VS-RDR-A-VA-RI.........IHACGYG.DVL..........PVHPTTESA
RSBRB_BACSU/147-272VAHQIFKLIEALN.LIG-VRSTL-SG-IRP-E-IA-QT.........AVQLGID.FSN.........ITIKTNLAQA
SUT1_STYHA/538-656GIHAFEELYKTLQ.KRE-VQLIL-AN-PGP-V-VI-EK.........LHASKLT.ELIG.......EDKIFLTVADA
SP2AA_BACCO/4-109GLGVILGRYKQIK.QKN-GEMIV-CA-ISP-A-VK-RL.........FELSGLF.KII..........RLDESEQYA
Y1739_MYCTU/443-553......QLRTELL.RRG-IVFAM-AR-VKQ-D-LR-ES.........LRAASLL.DKIG.......EDHIFMTLPTA
P71937_MYCTU/31-137AFAALADEAQRCR.CRG-IDLRL-VS-HQP-I-VA-RI.........AEAGGLS.RVL..........PIYPTVDTA
SP2AA_PAEPO/4-109GLGVILGRYKLIN.QKG-GEMAV-CD-VNP-P-VH-RL.........LDMSGLF.KIM..........PIYDNEVNA
SULX_YEAST/572-707AAQVLEEIITSYK.RRN-VFIYL-VN-VSI-N-DK-VRR.......RLFKAGVA.ASVERAQANNNENNTSNTFSDA
SUT21_ARATH/548-668GITALLELHNKLI.KTG-VELVI-VN-PKW-Q-VI-HK.........LNQAKFV.DRIG........GKVYLTIGEA
O83249_TREPA/5-107GLGVLISAYDEGL.KYQ-RRLCI-LN-PSE-S-VR-RA.........IELTGFS.EMF..........TVIKSLDEL
PHOT_BACSU/148-254TADQIFKLSHLLK.LTG-TELII-TG-IKP-E-LA-MK.........MNKLDAN.FSS.........LKTYSNVKDA
RSBS_BACSU/5-111IAKVLGDVITMSK.LMG-AKVVL-TG-IQP-A-VA-VT........LIELGIAL.EEI..........ETALDLEQG
O33206_MYCTU/385-486GARALLYFIDHSE.KDG-VAVSI-KR-IPP-R-LE-S...........QLTALA.DNEQ.......RDKLRTVLESA
RSBRA_BACSU/151-261VAHHIIQASEAVR.LVG-AKCLL-AG-IRP-E-IA-QT.........IVNLGID.LSQVI.....TKNTLQKGIQTA
SUT11_ARATH/518-636GIHSIEELLKSLE.KQE-IQLIL-AN-PGP-V-VI-EK.........LYASKFV.EEIG.......EKNIFLTVGDA
Y1081_THENE/1-106SLGVIVNILKSVS.SVG-GFFAL-VS-PNE-R-VE-RV.........LSITNLD.RIV..........KIYDTISEA
SUT3_STYHA/511-631GILALEELHKKLL.SRG-VELAM-VN-PRW-E-VI-HK.........LKVANFV.DKIG.......KERVFLTVAEA
SULH3_SCHPO/533-653ALFAFQRILKEYV.EHQ-VEVHL-VS-LDP-Q-VL-HI.........FEKHGLL.DLI..........GGYDHVQDS
YG35_YEAST/657-777AAEGFNRIKRFTE.TKR-IKLII-SS-IKE-R-DR-IYN.......AFNNVGLL.NDV..........ELFADLNSA
O33361_MYCTU/29-135GISLLCILDEDCR.AAG-VQWAL-VA-SPA-V-VE-QLG......GRCDQGEHE.SMF..........PMARSVHKA
O83551_TREPA/4-108GIGVLIYLCSTVK.KLK-IHFFI-SG-VHG-S-VK-KV.........IELTRLL.NYF..........PIAESVDEA
P73108_SYNY3/3-107ILVVLVNTYKELQ.SQN-RTLLL-SG-VSP-E-LK-II.........FELTQLN.RVF..........PIYSNPEVA
RSBRC_BACSU/163-272VAHQLFSLIEALR.LIG-VSSTL-SG-IRP-E-IA-QT.........AVQLGLS.FEG.........ISLRSTLASA
Q40008_HORVU/530-648GIHALEELLKALE.KRK-IQLIL-AN-PGP-A-VI-QK.........LRSAKFT.DLIG.......DDKIFLSVGDA

PF13466

Q310Z9_DESDG/492-572LVQLLCAAAAQAKE.RG.GRLES.EG.LPS.AGLM.QT---------LVLAGFD-----------------------
B5HV30_9ACTO/31-112AVDLLARLQLAARR.AG.GRIRL.RD.PDP.A.LH.AL---------LDLVGLR-----------------------
O33552_RHOSH/4-82AVQVLVSAARTAGA.TG.RRLVL.AQ.DHP.A.LT.DA---------FAGLALD-----------------------
A4WP58_RHOS5/4-82VVQVLLSAARSASM.TG.RTLSL.QC.AGS.P.LA.AQ---------LEALGIA-----------------------
A9BX84_DELAS/2-83ALAVLLACRRTAKA.AD.KQLVV.VG.LPQ.G.LQ.SM---------AALYGVD-----------------------
Q0K681_CUPNH/47-125AVAVLLAWNRAAAA.RN.QALSL.RG.VPP.Q.LS.QL---------ASLYGVD-----------------------
B5H529_STRPR/9-95AVDALARLHLTARR.HG.SRLRL.RN.AGP.D.LL.TL---------LDLVGLP-----------------------
Q0RDC2_FRAAA/24-104ALGVLLGGARRARA.AG.RSMVL.VD.VPS.A.LG.RM---------FAADRLG-----------------------
D1AD83_THECD/187-267ALAMLARAA.DARP.RG.GPLVL.DR.MPA.P.VR.SM---------VEMIGLD-----------------------
D2SCD5_GEOOG/29-109GLRVLAAGEALADS.RG.CTLQL.VG.PAP.F.TA.RL---------LRVVGMG-----------------------
A1VK31_POLNA/2-82ALAILLECRRQAMA.AG.KVFSV.QG.APG.R.LL.QL---------AEVYGVS-----------------------
A8ZVX1_DESOH/4-85FFQVICSAARSFAQ.RD.KHLAL.DA.PPP.AAFS.RQ---------LEKSGMA-----------------------
Q3SFW3_THIDA/281-359SVSQFISVLMQCLG.SG.KSITL.RG.HNA.L.IH.EL---------FRVMGID-----------------------
B9TGW9_RICCO/228-309GLALLLEWLRIAEV.KQ.KQVAL.TG.MPA.H.MQ.AL---------VRVGGLE-----------------------
A6F4X4_9ALTE/15-95VLSLLLCWHRLAVA.RS.QALRF.TG.VSE.R.LN.SL---------AALSGLD-----------------------
A1W422_ACISJ/2-83ALAVLLECRRAAVF.EN.RGFVV.KA.LPP.A.LS.SL---------AGLYGVQ-----------------------
A1U461_MARAV/15-95VLSMLLCWQRLALS.RH.CHLSF.TG.ASE.R.LR.SL---------AALSNLQ-----------------------
Q1N2W9_9GAMM/6-85AMQLLFGFHQALAT.DG.REPEW.LN.PSE.N.LR.NT---------AKILGLD-----------------------
A3JK96_9ALTE/17-97LLSVLLCWQRFARE.RS.LNLRF.AH.PGE.R.LL.AL---------AALANLN-----------------------
Q21UA2_RHOFD/4-85ALAVLLEFRRAALA.QG.KRFST.QG.LPK.R.LA.DL---------AALYGVV-----------------------
A3KIB8_STRAM/157-235GVRVLSRRAAGL.E.PG.RRLHV.VE.LAP.L.LC.QV---------ITMVGFD-----------------------
Q2P1Y1_XANOM/4-83SVQLLCAFVQTRRQ.AG.LHTEF.DG.CND.T.FR.DA---------ARLLGVT-----------------------
B1Y2Z1_LEPCP/2-84ALGLLLSCRRHAQT.HG.RGFST.QA.LPQ.R.LV.RL---------ASLYGLS-----------------------
Q8EEQ5_SHEON/14-91GLQWLLALKGL..N.VV.QRVEF.CH.HSK.A.VI.DA---------LELSGLS-----------------------
D2S5L7_GEOOG/30-110GIRGLGTAYRRALR.HD.RRLGL.TG.APP.F.LH.QE---------LIRLRLD-----------------------
A7MNS4_CROS8/14-91GLALLVHLVALTQA.GG.RGVTL.EG.MSE.N.LT.TL---------AKLYNLP-----------------------
Q2SFX7_HAHCH/14-84GLQLLILAKRD.......RGARL.VN.ASE.A.VN.KV---------FSLTGLA-----------------------
A7MSC9_VIBHB/15-94GMVMLIHLLEHAKK.QN.CHIML.SF.VPA.Q.LR.TL---------FQLSNVE-----------------------
B9JTP2_AGRVS/23-100CAQVLVSGAKTWEE.DQ.KTFSI.KK.ASD.A.FT.KT---------IQLLGLN-----------------------
A6E679_9RHOB/5-84TIQVLVSAFVTAQG.AA.HRFAV.DM.PAQSV.LE.TA---------FDRLGLL-----------------------
B8DPA7_DESVM/571-651LVQLLQSAAVTARA.RG.VDLAA.TGLVSE.A.VA.EA---------ARRTGLD-----------------------
C6C1P3_DESAD/15-93GASLFMMMKAGCRD.RG.SSLVI.NG.LRP.E.FA.SF---------LELFDLD-----------------------
E3I167_RHOVT/14-94ILQVLIAADIAGEK.LG.RTITL.LRVPEG.A.VE.AS---------FARAGLA-----------------------
B4VGC8_9ACTO/25-99FLNLLLRLHHAT.......GLRI.AA.PGE.Q.LR.RL---------FALTGAD-----------------------
E3IYM7_FRASU/24-104GLAALLRADLLLRR.VR.GSLEI.RS.ATP.A.FL.EL---------VTATGLT-----------------------
C1D624_LARHH/5-83ALALALELSREAGQ.HG.HSLQH.LH.LPV.E.VE.SL---------IDLYGLQ-----------------------
A4YXB4_BRASO/320-399FLGLLLMLRKQLDS.QG.CTATF.AG.VSP.Q.LA.RI---------FHFGGLE-----------------------
B8L741_9GAMM/14-91GLALLAELAARARK.AG.HPLAI.SG.APA.G.YN.EL---------SAAYRLS-----------------------
D1C014_XYLCX/37-113GVAFLARLATRM....P.QKVRI.LR.APP.T.VR.FL---------LDVTRIG-----------------------
C6WD00_ACTMD/919-1001GVALLLEAAEVAAG.RG.RGVGVVVT.EGS.A.PA.RI---------MAVSGLH-----------------------
A9CYE8_9RHIZ/11-88CVQVLLSAVQSWQA.DD.QSFKV.AQ.ASD.A.YI.KT---------LQLLGIS-----------------------
E3J1T6_FRASU/56-136GLRALVASAGNLHR.DG.RGLVL.HA.VAP.W.LL.GL---------LIVTGWD-----------------------
C6WQ84_ACTMD/60-139GLAALTAAYLRAGG.RT.RLLVV.AG..HR.A.VL.RP---------LRIAALD-----------------------
Q2SPQ4_HAHCH/13-91ALQLLLAVQKRQLS.HG.GGIDW.LE.ASD.Y.MK.QV---------VRLLSLQ-----------------------
D0FND2_ERWPE/14-91GLALLVHLRQIAID.NG.RKPRF.SG.VTD.K.LN.SL---------ITLYNLQ-----------------------
D2SFP4_GEOOG/531-612AVRVVLAMARIAGE.EG.WRLVV.HA.PEG.G.VTRHV---------LEISGLG-----------------------
D2B5R7_STRRD/72-150GTWLLAQAAHSL.P.TG.KKVFL.HH.APY.C.LR.SV---------LALIGPD-----------------------
B8DLB2_DESVM/179-259GIAVLAELVRHARG.LG.RAVRI.SG.VSP.N.LS.TV---------FDVVGIA-----------------------
A6D4D8_9VIBR/13-92GLVMLIHLLEHAKN.RK.CHIML.SF.VPD.E.LK.IL---------FQLYNVE-----------------------
A3PIP6_RHOS1/5-82ALQLLLAAAAKWRA.EG.HQFTC.QP.MSP.A.FT.DD---------VTRLGVD-----------------------
A3WPY6_9GAMM/16-94GVAILLEVIKHNRD.A..VPLQC.KG.SSE.Q.LR.QI---------VTVSGVD-----------------------
D0SFB4_ACIJO/9-88ALAVLVRWLRQTPD.A..HSLHF.KA.VPE.K.MM.KV---------IQACHLQ-----------------------
D4DRH6_NEIEG/1-77CLSLLFSVLR...R.NG.SRPEL.RH.MPP.A.VA.DL---------AELYEVR-----------------------
D0KEM1_PECWW/14-90GLALLMHVYQQP.Y.SG.DEITI.VG.ASD.R.LK.TL---------IALYNLN-----------------------
D0KYU0_HALNC/26-108GVAFLLGWQAEAAA.QS.VTVRY.TH.PPK.A.MR.AM---------MRVYDLD-----------------------
D4F180_EDWTA/15-90GLALLLHVQNLC...PG.TPLPL.RG.VSD.R.LH.TL---------IALYNLH-----------------------
D5X3Z8_THIK1/566-644SAGALLNWAMMQHD.QG.KTLQF.TG.VHR.L.IA.GL---------FSILGLH-----------------------
B9J943_AGRRK/10-87CIQVIMAAAKTWDE.DK.LSFTF.SK.VSD.A.FQ.KT---------LQMIGID-----------------------
C3JRM8_RHOER/87-163VANAVVDAA...GR.GN.NRIRL.FA.PTR.A.VS.MI---------FQALGAS-----------------------
C6NT90_9GAMM/20-97TLALLLDWQERALQ.RK.RPLVL.TG.LGP.G.LR.EL---------VHLYGLE-----------------------
B1W2W2_STRGG/20-107LVEAVARLALVARR.SG.RTLRL.RR.VPP.E.LR.SL---------LDLVGLA-----------------------
B9XQZ5_9BACT/43-124GFAFLYLLSKGCMT.PQ.SQVSL.NG.LKP.E.YQ.KA---------LQNYSME-----------------------
B4UM51_ANASK/12-87GLAVLAQAL...SA.RG.IRVSF.RG.LGQ.H.QL.RL---------LRYLGLD-----------------------
A1SBD9_SHEAM/6-85GLQLLLCLQSHCEN.SS.IPLNW.KG.ITT.E.LV.AQ---------FKQMGMQ-----------------------
A0LC67_MAGSM/14-94VLGMFLMLRAHAGE.AE.ADITL.RN.PTN.L.VL.RM---------LLAARFD-----------------------
C7D676_9RHOB/11-91GVQIVFATAAYAGA.RG.KQVFL.RH.AND.P.IR.QD---------LALFGLT-----------------------
A4YMN9_BRASO/16-97SSGMLMFLSATAKS.KN.KSLGV.SN.ANQ.Q.VL.AV---------MHKANLG-----------------------
C7LTF6_DESBD/15-91FVQILCSLLK...D.ED.KRISF.VN.LPT.H.LL.EN---------AASLGAD-----------------------
B1LTK1_METRJ/26-107GAWVLERTRAEIEQ.AG.SALTY.LG.ARP.E.HR.IL---------LGEVRLR-----------------------
B0U4D0_XYLFM/14-94GVALLAEVMERIRVQVG.SVPTI.VA.PPA.G.LK.EL---------LAAYRMS-----------------------
Q0RZA3_RHOSR/48-126ALAVLADAGTRLRE.QR.SRLTV.AA..FG.P.LR.HI---------LDDAGID-----------------------
C5BID3_TERTT/281-360FIAFLLLMDCRLQK.YH.SRLEI.IA.VSD.A.LA.KT---------FQQQGVA-----------------------
D0W2G3_NEICI/10-87CVSLLLEILRRR....K.DSIKL.TG.IPE.S.VR.AL---------SELYEIK-----------------------
Q58IT2_9ACTO/27-106CAYALLRAA.TLRP.KP.AVLRI.HG.ARR.A.VQ.RT---------LRHAGLD-----------------------
Q2SBJ1_HAHCH/18-100LISLLLRLVAAAEA.KG.LNVSV.SG.LTG.K.MF.DI---------ARVSGVE-----------------------
B4D414_9BACT/18-99FMGTLAGIALRLRE.LGQGNLRV.TN.LNE.R.NS.DL---------LSNLGLD-----------------------
D5VNV2_CAUST/4-81CLQVLLAARKAWDH.DG.QSFSI.KG.PSE.A.FV.ET---------TRLFGAE-----------------------
B5HHQ5_STRPR/28-107CAYGLLRAVTVAPE.A..AVITV.RG.ARR.G.VV.RT---------LRQAGLD-----------------------
Q1QXI2_CHRSD/17-99ALGFLAKVAMAVEGRLE.QPPTI.VA.EHP.D.VR.RM---------LDVMGFS-----------------------
Q12BT3_POLSJ/427-501CLGTVHELVG......R.GRVVL.AG.VTP.V.VR.AL---------FEELSMD-----------------------
C6E422_GEOSM/12-96GCQLLALFLENLRR.HG.IIPTA.CH.LGP.E.TA.AR---------ISLLGFS-----------------------
C9R4W7_AGGAD/20-98GFALLCDFLNERKQ.L......L.QN.PPS.Q.LL.TL---------ADLFGLS-----------------------
D9T369_MICAI/189-267...SLLHLRDHARR.HD.AVAVL.RT.PSR.A.PA.RL---------VDLLGLS-----------------------
Q31HM4_THICR/6-86GLQALLALIKSAMA.NQ.KKIQW.DS.PTD.T.LK.MG---------AEKLGLT-----------------------
C4RJ05_9ACTO/208-288TAALLTRLALRA....P.SGVRL.IG.YHG.P.VA.RV---------LACLGIT-----------------------
Q31GZ5_THICR/18-93CLALLLYFQSLI....D.HPLKV.LS.LPD.D.LK.VL---------VNLYNLD-----------------------
A7H922_ANADF/18-92GVAALAHGLAGG....R.QRLLM.RG.LRQ.H.QL.RI---------FRYFGVD-----------------------
Q21SV7_RHOFD/514-592AAGSILNWVALRES.EG.CSVQF.RD.VPR.L.VA.AF---------FNVIGIN-----------------------
B0BQM2_ACTPJ/20-100GFTLLAELLNYYQK.QT.PNCLI.H..VPE.V.VK.TL---------ADLFDLT-----------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window