Sequence alignment for CL0517

PF13813

Q5B2E7_EMENI/234-322--------------------------------------------------------------------------------
Q5B9S2_EMENI/238-325--------------------------------------------------------------------------------
Q5AR60_EMENI/251-335--------------------------------------------------------------------------------
Q5BD08_EMENI/258-345--------------------------------------------------------------------------------
Q5BB23_EMENI/325-418--------------------------------------------------------------------------------
A8N7P7_COPC7/230-318--------------------------------------------------------------------------------
A8N7Q6_COPC7/205-291--------------------------------------------------------------------------------
A8N7W1_COPC7/216-300--------------------------------------------------------------------------------
YNV5_SCHPO/228-305--------------------------------------------------------------------------------
B0DN88_LACBS/223-307--------------------------------------------------------------------------------
B0CTS2_LACBS/198-285--------------------------------------------------------------------------------
B0CP14_LACBS/223-309--------------------------------------------------------------------------------
B8PNC8_POSPM/221-304--------------------------------------------------------------------------------
B0DP95_LACBS/215-299--------------------------------------------------------------------------------
B0DPA1_LACBS/215-299--------------------------------------------------------------------------------
B8PN91_POSPM/156-242--------------------------------------------------------------------------------
B0D1K8_LACBS/215-302--------------------------------------------------------------------------------
A1DAU4_NEOFI/241-329--------------------------------------------------------------------------------
B8NI41_ASPFN/244-334--------------------------------------------------------------------------------
B0D1K5_LACBS/216-304--------------------------------------------------------------------------------
Q0CB16_ASPTN/235-323--------------------------------------------------------------------------------
Q0CB78_ASPTN/235-323--------------------------------------------------------------------------------
A5BHD5_VITVI/183-271--------------------------------------------------------------------------------
WAXS4_ARATH/175-263--------------------------------------------------------------------------------
B0D1K6_LACBS/216-303--------------------------------------------------------------------------------
B0DRX8_LACBS/207-292--------------------------------------------------------------------------------
B6QRT0_PENMQ/256-344--------------------------------------------------------------------------------
B8P281_POSPM/564-647--------------------------------------------------------------------------------
C5GEJ3_AJEDR/220-310--------------------------------------------------------------------------------
B0D1K7_LACBS/218-306--------------------------------------------------------------------------------
B0DA43_LACBS/265-345--------------------------------------------------------------------------------
D1LC97_9HYPO/252-340--------------------------------------------------------------------------------
Q96W92_GIBZA/251-341--------------------------------------------------------------------------------
B6HN05_PENCW/246-334--------------------------------------------------------------------------------
Q2US74_ASPOR/254-342--------------------------------------------------------------------------------
Q2UE90_ASPOR/249-338--------------------------------------------------------------------------------
C5P066_COCP7/258-347--------------------------------------------------------------------------------
C5PCP4_COCP7/167-251--------------------------------------------------------------------------------
B0Y9M2_ASPFC/246-333--------------------------------------------------------------------------------
C4JIX8_UNCRE/259-348--------------------------------------------------------------------------------
C7ZCA2_NECH7/246-334--------------------------------------------------------------------------------
B6H3A9_PENCW/233-321--------------------------------------------------------------------------------
A2QRU6_ASPNC/230-318--------------------------------------------------------------------------------
A8NTB7_COPC7/251-331--------------------------------------------------------------------------------
ASAT1_ARATH/180-267--------------------------------------------------------------------------------
A1C4D4_ASPCL/251-338--------------------------------------------------------------------------------
B6HRC6_PENCW/265-351--------------------------------------------------------------------------------
C5FXZ8_ARTOC/242-330--------------------------------------------------------------------------------
Q0CDC3_ASPTN/224-312--------------------------------------------------------------------------------
WAXS5_ARATH/175-263--------------------------------------------------------------------------------
C6TIL0_SOYBN/192-280--------------------------------------------------------------------------------
A1D2V2_NEOFI/225-313--------------------------------------------------------------------------------
A1DC18_NEOFI/245-333--------------------------------------------------------------------------------
B6HKP3_PENCW/224-312--------------------------------------------------------------------------------
Q0CS68_ASPTN/137-225--------------------------------------------------------------------------------
B6HN85_PENCW/288-374--------------------------------------------------------------------------------
D4DFW4_TRIVH/660-754--------------------------------------------------------------------------------
D4DK35_TRIVH/255-353--------------------------------------------------------------------------------
A1DEF4_NEOFI/254-338--------------------------------------------------------------------------------
B0CVR7_LACBS/274-353--------------------------------------------------------------------------------
B8NF28_ASPFN/25-113--------------------------------------------------------------------------------
B6H8B2_PENCW/235-322--------------------------------------------------------------------------------
B8M887_TALSN/166-252--------------------------------------------------------------------------------
Q6Q889_LEPMC/242-327--------------------------------------------------------------------------------
Q0CRW1_ASPTN/238-326--------------------------------------------------------------------------------
Q5KNT5_CRYNJ/307-391--------------------------------------------------------------------------------
Q0C7G9_ASPTN/642-728--------------------------------------------------------------------------------
C9SDD4_VERA1/226-317--------------------------------------------------------------------------------
B9HCG3_POPTR/129-219--------------------------------------------------------------------------------
B6QWC0_PENMQ/779-867--------------------------------------------------------------------------------
D4AQU2_ARTBC/243-333--------------------------------------------------------------------------------
C5FGQ3_ARTOC/253-336--------------------------------------------------------------------------------
C5XF80_SORBI/188-267--------------------------------------------------------------------------------
Q0UA02_PHANO/249-339--------------------------------------------------------------------------------
C5JC80_AJEDS/224-314--------------------------------------------------------------------------------
B6HGV9_PENCW/239-312--------------------------------------------------------------------------------
C5P323_COCP7/246-336--------------------------------------------------------------------------------
D4DL18_TRIVH/237-325--------------------------------------------------------------------------------
Q0ULA5_PHANO/246-323--------------------------------------------------------------------------------
A6SHP6_BOTFB/195-284--------------------------------------------------------------------------------
B2W4U1_PYRTR/280-366--------------------------------------------------------------------------------
Q11QG1_CYTH3/167-243--------------------------------------------------------------------------------
B7G275_PHATC/248-337--------------------------------------------------------------------------------
A3ZXR5_9PLAN/169-248--------------------------------------------------------------------------------
A7ETV0_SCLS1/27-116--------------------------------------------------------------------------------
A1CLH2_ASPCL/277-368--------------------------------------------------------------------------------
A1D5T3_NEOFI/290-381--------------------------------------------------------------------------------
A9B779_HERA2/181-260--------------------------------------------------------------------------------
A2R9E5_ASPNC/443-536--------------------------------------------------------------------------------
C4JNF5_UNCRE/338-429--------------------------------------------------------------------------------
B6HMX5_PENCW/331-421--------------------------------------------------------------------------------
A1C9Z9_ASPCL/340-433--------------------------------------------------------------------------------
D4ASB5_ARTBC/344-439--------------------------------------------------------------------------------
A9B206_HERA2/178-253--------------------------------------------------------------------------------
C7YGR5_NECH7/341-430--------------------------------------------------------------------------------
A6RHB9_AJECN/147-239--------------------------------------------------------------------------------
C5GAL9_AJEDR/357-446--------------------------------------------------------------------------------
Q0UFW4_PHANO/200-286--------------------------------------------------------------------------------
C5FVY5_ARTOC/341-437--------------------------------------------------------------------------------
B8MBR3_TALSN/324-425--------------------------------------------------------------------------------
Q0HJ90_SHESM/25-98--------------------------------------------------------------------------------

PF03062

YA71_SCHPO/187-531SLKNSIFNPLLTWTLDISVVFFKEYFAYCKFSSLHPGLGFLDQYTGILERWYVLFNITMLRLVSFNMDYYWSLKHNS...
MBOA7_HUMAN/218-419REDAFYARPLPARLFYMIPV.FFAFRMRFYVAWIAAECGCI.......................................
PORCN_HUMAN/115-402VDTVTWHKMRGAQMI.......VAMKAVSLGFDLDRGE..........................................
MBOA7_CAEEL/100-411PVNEVASHTNVIQLI.......ITLRIIGITFEENDAW..............VHKSD.......................
MBOA5_MOUSE/126-437LAGYYYTATGDYDIKWTMPHCVLTLKLIGLCIDYYDGGKDGNSLTSEQQKYA............................
O18241_CAEEL/167-455FSSGTHIFYREFNIYL.....YGSIKILNLALFLCDLKPGKSDF....................................
O01925_CAEEL/102-410LIGYWFHETDTYDITWTTPFCIMTLRFIGLVMDVYDGAQKPEHLKPDQKLTA............................
ARE1_YEAST/202-609IRCCTDYYASYGSAWNKLEIVQYMTTDLFTIAMLDLAMFLCTFFVVFVHWLVKKRIINWKWTGFVAVSIFELAFIPVTFP
ARE2_YEAST/215-641FSGLYVAFWMAIAFGAVKALIDYYYQHNGSFKDSEILKFMTTNLFTVASVDLLMYLSTYFVVGIQYLCKWGVLKWGTTGW
AREH1_SCHPO/188-536VLAVYWVKHRDFPIVQCVFFTLHCAVLIMKQFSYSHHMGYISEIRILHNEYEKLLKFVRECLNSTEKDEKYTFELTFPNK
Q17498_CAEEL/120-435YEHWSTIPSKNTDLASNLPFVTAYVTYLAAFFYFPLKFLYESDLKCACSFIITCETTRIAMKVHSF..............
SOAT1_HUMAN/171-520FSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPP
SOAT2_HUMAN/149-494LLLEFDLLIFSFGQLPLALVTWVPM.FLSTLLAPYQALRLWARGTWTQATGLGCALLAAHAVVLCALPVHVAVEHQLPPA
DGAT1_HUMAN/153-474RLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCR.............
DLTB_BACSU/102-391FLSHPQPHHPPHNLISFLGISYLTFKGVQLIMEA..................RD..........................
Q53662_STAAU/117-404GHQIHFHESKLIEFVGFLGISYVTFKSVQLIMEIRDG...........................................
Q9X2N5_STAXY/117-404AAQLKLHENKVIEFIGFLGISYVTFKSVQLLMEIRDG...........................................
Q9S390_LISMN/99-390ISKVVPILGDHVTMVGFLGISYLTFKATQMIIEIRDN...........................................
DLTB_LACRH/103-398VVKFTPLFQHHGSILGFLGISYLTFRVVGTIMEIRDG...........................................
Q9CG50_LACLA/100-390VHPLFNPGPGPGSILGFLGISYISFKTVAMIMEIRDG...........................................
O68577_STRMU/108-400VKITPAIWTNQQSLFGFLGISYLTFRSVGMIMEMRDG...........................................
Q97N83_STRPN/106-398FVKVQPAINGTQSLLGFLGISYLTFRSVGIVIELRDG...........................................
Q99ZA7_STRP1/108-400VKVAPLTGPSSQTLFSFLGISYLTFKSIGMIIEMRDG...........................................
O25526_HELPY/120-426FNLIWKSHFETLHLILPLAISFFTLQQIAYLMDTYKQNQIMQPKMRERVSENAPIL........................
Q9ALT7_CAMJU/111-405KLAHLDFNIPLPHILLPLGISFFTFQQIAFLVDCYKKSNIEDLL....................................
ALGI_AZOVI/108-385TSFGVEPFVVTHILLP.IGISFYVFESISYIIDVYRGD..........................................
Q97IS6_CLOAB/110-386NYKLSIPNIALP.....IGISYFTFKAISYVVDVYKNK..........................................
O83577_TREPA/112-399AQHTWHQHVKDWNIWHPVGISYCTFKCMSYVFDVYLCK..........................................
GUP2_YEAST/202-559IAAFAIWSYGIFTLFINQKMKNLPFNNIAIILSPMDQWYKGIVPRWDFFFNFTLLRLLSYSMDFLERWHEQLSRQPSIDY
GUP1_YEAST/170-510IATISIWIYGISTLFINDNFRAYPFGNICSFLSPLDHWYRGIIPRWDVFFNFTLLRVLSYNLDFLERWENLQKKK.....
Q9C693_ARATH/108-343MSLIYLIYLHGACVIYILSIATANFLLVKLDMPQNTLSFKDVAWYGVR................................
HHAT_HUMAN/125-442FCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFS....................
HHAT_DROME/127-444TLIASYYIVSLLSLKFLVWLLSAGWILCINVMQKNVWWTDRVGYTEYVLVIVTMSWSVLRGC..................
NESSY_DROME/114-421LLGYFYTSSNDYDILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETA............................
ALE1_SCHPO/114-426IYPSENTDITASQMV.......LCMKLTAFAWSVYDGRLPSSELSSYQKDRA............................
ALE1_YEAST/111-445IHAQFLNEQTQTTVDITSSQMVLAMKLTSFAWSYYDGSCTSESDFKDLTEHQKS..........................
Q9CAN8_ARATH/104-417VFYMSGDAWKEGGIDSTGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNR............................
Q9XUB0_CAEEL/123-366FYRWIYQETYNLGFTGSMMVAVGKITLLSSAITDGMRSDLKALNSGQKRDA.............................
Q9VMD5_DROME/93-427FYFGIPGHTNMIQMILTLKVSGIAFEKTAAWKRLQAHDEQKKNDQRDVHQESPIEI........................
Q9I935_XENLA/115-402VDTVSWHKMRGAQMI.......VAMKAVSLGFDVDRGA..........................................
PORCN_DROME/126-459IILQITVGYRLLLLLLLAAVGYLLLQLLRLGRRGAQVLAVLTVGSQFLYELLIWRRRSDWPQLRGIQMV...........

PF13813

Q5B2E7_EMENI/234-322--------------------------------------------------------------------------------
Q5B9S2_EMENI/238-325--------------------------------------------------------------------------------
Q5AR60_EMENI/251-335--------------------------------------------------------------------------------
Q5BD08_EMENI/258-345--------------------------------------------------------------------------------
Q5BB23_EMENI/325-418--------------------------------------------------------------------------------
A8N7P7_COPC7/230-318--------------------------------------------------------------------------------
A8N7Q6_COPC7/205-291--------------------------------------------------------------------------------
A8N7W1_COPC7/216-300--------------------------------------------------------------------------------
YNV5_SCHPO/228-305--------------------------------------------------------------------------------
B0DN88_LACBS/223-307--------------------------------------------------------------------------------
B0CTS2_LACBS/198-285--------------------------------------------------------------------------------
B0CP14_LACBS/223-309--------------------------------------------------------------------------------
B8PNC8_POSPM/221-304--------------------------------------------------------------------------------
B0DP95_LACBS/215-299--------------------------------------------------------------------------------
B0DPA1_LACBS/215-299--------------------------------------------------------------------------------
B8PN91_POSPM/156-242--------------------------------------------------------------------------------
B0D1K8_LACBS/215-302--------------------------------------------------------------------------------
A1DAU4_NEOFI/241-329--------------------------------------------------------------------------------
B8NI41_ASPFN/244-334--------------------------------------------------------------------------------
B0D1K5_LACBS/216-304--------------------------------------------------------------------------------
Q0CB16_ASPTN/235-323--------------------------------------------------------------------------------
Q0CB78_ASPTN/235-323--------------------------------------------------------------------------------
A5BHD5_VITVI/183-271--------------------------------------------------------------------------------
WAXS4_ARATH/175-263--------------------------------------------------------------------------------
B0D1K6_LACBS/216-303--------------------------------------------------------------------------------
B0DRX8_LACBS/207-292--------------------------------------------------------------------------------
B6QRT0_PENMQ/256-344--------------------------------------------------------------------------------
B8P281_POSPM/564-647--------------------------------------------------------------------------------
C5GEJ3_AJEDR/220-310--------------------------------------------------------------------------------
B0D1K7_LACBS/218-306--------------------------------------------------------------------------------
B0DA43_LACBS/265-345--------------------------------------------------------------------------------
D1LC97_9HYPO/252-340--------------------------------------------------------------------------------
Q96W92_GIBZA/251-341--------------------------------------------------------------------------------
B6HN05_PENCW/246-334--------------------------------------------------------------------------------
Q2US74_ASPOR/254-342--------------------------------------------------------------------------------
Q2UE90_ASPOR/249-338--------------------------------------------------------------------------------
C5P066_COCP7/258-347--------------------------------------------------------------------------------
C5PCP4_COCP7/167-251--------------------------------------------------------------------------------
B0Y9M2_ASPFC/246-333--------------------------------------------------------------------------------
C4JIX8_UNCRE/259-348--------------------------------------------------------------------------------
C7ZCA2_NECH7/246-334--------------------------------------------------------------------------------
B6H3A9_PENCW/233-321--------------------------------------------------------------------------------
A2QRU6_ASPNC/230-318--------------------------------------------------------------------------------
A8NTB7_COPC7/251-331--------------------------------------------------------------------------------
ASAT1_ARATH/180-267--------------------------------------------------------------------------------
A1C4D4_ASPCL/251-338--------------------------------------------------------------------------------
B6HRC6_PENCW/265-351--------------------------------------------------------------------------------
C5FXZ8_ARTOC/242-330--------------------------------------------------------------------------------
Q0CDC3_ASPTN/224-312--------------------------------------------------------------------------------
WAXS5_ARATH/175-263--------------------------------------------------------------------------------
C6TIL0_SOYBN/192-280--------------------------------------------------------------------------------
A1D2V2_NEOFI/225-313--------------------------------------------------------------------------------
A1DC18_NEOFI/245-333--------------------------------------------------------------------------------
B6HKP3_PENCW/224-312--------------------------------------------------------------------------------
Q0CS68_ASPTN/137-225--------------------------------------------------------------------------------
B6HN85_PENCW/288-374--------------------------------------------------------------------------------
D4DFW4_TRIVH/660-754--------------------------------------------------------------------------------
D4DK35_TRIVH/255-353--------------------------------------------------------------------------------
A1DEF4_NEOFI/254-338--------------------------------------------------------------------------------
B0CVR7_LACBS/274-353--------------------------------------------------------------------------------
B8NF28_ASPFN/25-113--------------------------------------------------------------------------------
B6H8B2_PENCW/235-322--------------------------------------------------------------------------------
B8M887_TALSN/166-252--------------------------------------------------------------------------------
Q6Q889_LEPMC/242-327--------------------------------------------------------------------------------
Q0CRW1_ASPTN/238-326--------------------------------------------------------------------------------
Q5KNT5_CRYNJ/307-391--------------------------------------------------------------------------------
Q0C7G9_ASPTN/642-728--------------------------------------------------------------------------------
C9SDD4_VERA1/226-317--------------------------------------------------------------------------------
B9HCG3_POPTR/129-219--------------------------------------------------------------------------------
B6QWC0_PENMQ/779-867--------------------------------------------------------------------------------
D4AQU2_ARTBC/243-333--------------------------------------------------------------------------------
C5FGQ3_ARTOC/253-336--------------------------------------------------------------------------------
C5XF80_SORBI/188-267--------------------------------------------------------------------------------
Q0UA02_PHANO/249-339--------------------------------------------------------------------------------
C5JC80_AJEDS/224-314--------------------------------------------------------------------------------
B6HGV9_PENCW/239-312--------------------------------------------------------------------------------
C5P323_COCP7/246-336--------------------------------------------------------------------------------
D4DL18_TRIVH/237-325--------------------------------------------------------------------------------
Q0ULA5_PHANO/246-323--------------------------------------------------------------------------------
A6SHP6_BOTFB/195-284--------------------------------------------------------------------------------
B2W4U1_PYRTR/280-366--------------------------------------------------------------------------------
Q11QG1_CYTH3/167-243--------------------------------------------------------------------------------
B7G275_PHATC/248-337--------------------------------------------------------------------------------
A3ZXR5_9PLAN/169-248--------------------------------------------------------------------------------
A7ETV0_SCLS1/27-116--------------------------------------------------------------------------------
A1CLH2_ASPCL/277-368--------------------------------------------------------------------------------
A1D5T3_NEOFI/290-381--------------------------------------------------------------------------------
A9B779_HERA2/181-260--------------------------------------------------------------------------------
A2R9E5_ASPNC/443-536--------------------------------------------------------------------------------
C4JNF5_UNCRE/338-429--------------------------------------------------------------------------------
B6HMX5_PENCW/331-421--------------------------------------------------------------------------------
A1C9Z9_ASPCL/340-433--------------------------------------------------------------------------------
D4ASB5_ARTBC/344-439--------------------------------------------------------------------------------
A9B206_HERA2/178-253--------------------------------------------------------------------------------
C7YGR5_NECH7/341-430--------------------------------------------------------------------------------
A6RHB9_AJECN/147-239--------------------------------------------------------------------------------
C5GAL9_AJEDR/357-446--------------------------------------------------------------------------------
Q0UFW4_PHANO/200-286--------------------------------------------------------------------------------
C5FVY5_ARTOC/341-437--------------------------------------------------------------------------------
B8MBR3_TALSN/324-425--------------------------------------------------------------------------------
Q0HJ90_SHESM/25-98--------------------------------------------------------------------------------

PF03062

YA71_SCHPO/187-531............EKLNTLIFDKDREPTTLTFRERVDYSCLDEDYNLKNFLTYIFYAP...................LYLA
MBOA7_HUMAN/218-419.............................................AAGFGAYPVAAK..................ARAGG
PORCN_HUMAN/115-402.......................................VGTVPSPVEFMGYLYFVG...................TIVF
MBOA7_CAEEL/100-411................................ENPTKRYLTELPTILEKFAYFYHFC...................GLFT
MBOA5_MOUSE/126-437.......................................IRGVPSLLEVAGFSYFYG...................AFLV
O18241_CAEEL/167-455.......................................SKIMADSLIYFSYLPYSM...................TLIV
O01925_CAEEL/102-410.......................................ISDKPGLLEIAAFGLFFQ...................GTLV
ARE1_YEAST/202-609IY......VYYFDFNWVTRIFLFLHSVVFVMKSHSFAFYNGYLWDIKQELEYSSKQLQ................KYKESL
ARE2_YEAST/215-641IFTSIYEFLFVIFYMYLTENILKLHWLSKIFLFLHSLVLLMKMHSFAFYNGYLWGIKEELQFSKSALAKYKDSINDPKVI
AREH1_SCHPO/188-536.........PAETISTLQAEEIVALTAKYLSRQMRSEVGNVVYPDNINFFNYVDY......................LLV
Q17498_CAEEL/120-435.......................IRENWDRAMKRKIGGTIDAWPTMEQFLYYQFC.........................
SOAT1_HUMAN/171-520AS.....RFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF.......................LF
SOAT2_HUMAN/149-494S........RCVLVFEQVRFLMKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYF......................LFC
DGAT1_HUMAN/153-474......................RARAKAASAGKKASSAAAPHTVSYPDNLTYRDLY....................YFLF
DLTB_BACSU/102-391.....................................GLLKEQLPLHRLLYFILFFP...................TISS
Q53662_STAAU/117-404.......................................SIKEIKVWKLIQFISFFP...................TISS
Q9X2N5_STAXY/117-404.......................................SIKEVKATKVFQFISFFP...................TISS
Q9S390_LISMN/99-390.......................................LIKQYNAWDFVNFLLFFP...................TISS
DLTB_LACRH/103-398.......................................SIKDLNMWKFIQFLLFFP...................TISS
Q9CG50_LACLA/100-390.......................................LIKAVPLKEFLYFLYFYP...................TISS
O68577_STRMU/108-400.......................................VLTSFTFWEFIRFMLFMP...................TFSS
Q97N83_STRPN/106-398.......................................VIKDFTLWEFLRFLLFMP...................TFSS
Q99ZA7_STRP1/108-400.......................................TLQEVRLPDFIRFMIFFP...................TFSS
O25526_HELPY/120-426.................................LNPPTSFFSLSHFLDYALFVSFFP...................QLIA
Q9ALT7_CAMJU/111-405.......................................ENKKVDFIDYCLFISFFP...................QLIA
ALGI_AZOVI/108-385.......................................TPATRNLVDFAAFVAIFP...................HLIA
Q97IS6_CLOAB/110-386.......................................VEAEKNPLNIGLYIAFFP...................EVIS
O83577_TREPA/112-399.......................................IRRREPFARVLLYVSFFP...................QMIS
GUP2_YEAST/202-559DDRR..PEFRKSLSGSTLQTIYESGKNVLEEKERLVAEHHIQDYNFINFIAYITYAP...................LFLV
GUP1_YEAST/170-510..............SPSYESKEAKSAILLNERARLTAAHPIQDYSLMNYIAYVTYTP...................LFIA
Q9C693_ARATH/108-343.......................................WLFSFLLIELMTHLFYYN..................AFVIS
HHAT_HUMAN/125-442.............................LELCWQQLPAASTSYSFPWMLAYVFYYP...................VLHN
HHAT_DROME/127-444...........................SYSLSKIGAKQEDLTRYSLVQYLGYAMYFP...................CLTY
NESSY_DROME/114-421.......................................LKKPPSLLELLAFSYFPS...................GFLV
ALE1_SCHPO/114-426.......................................LRKIPNILYFLGYVFFFP...................SLLV
ALE1_YEAST/111-445.....................................RAVRGHPPLLKFLAYAFFYS...................TLLT
Q9CAN8_ARATH/104-417.......................................LIQMPSLIEYFGYCLCCG...................SHFA
Q9XUB0_CAEEL/123-366.......................................VNEIPSLLDFASYMFAFQ...................SVII
Q9VMD5_DROME/93-427..................................TDYDVELQSLSAAEILHYSFNYI...................GVLT
Q9I935_XENLA/115-402.......................................VRSIPSPVEFMGYVYFVG...................TVIF
PORCN_DROME/126-459.....................VNMKLISLGFDLTASGQLQARIPGPFAYLGYIYSPA...................TCAL

PF13813

Q5B2E7_EMENI/234-322--------------------------------------------------------------------------------
Q5B9S2_EMENI/238-325--------------------------------------------------------------------------------
Q5AR60_EMENI/251-335--------------------------------------------------------------------------------
Q5BD08_EMENI/258-345--------------------------------------------------------------------------------
Q5BB23_EMENI/325-418--------------------------------------------------------------------------------
A8N7P7_COPC7/230-318--------------------------------------------------------------------------------
A8N7Q6_COPC7/205-291--------------------------------------------------------------------------------
A8N7W1_COPC7/216-300--------------------------------------------------------------------------------
YNV5_SCHPO/228-305--------------------------------------------------------------------------------
B0DN88_LACBS/223-307--------------------------------------------------------------------------------
B0CTS2_LACBS/198-285--------------------------------------------------------------------------------
B0CP14_LACBS/223-309--------------------------------------------------------------------------------
B8PNC8_POSPM/221-304--------------------------------------------------------------------------------
B0DP95_LACBS/215-299--------------------------------------------------------------------------------
B0DPA1_LACBS/215-299--------------------------------------------------------------------------------
B8PN91_POSPM/156-242--------------------------------------------------------------------------------
B0D1K8_LACBS/215-302--------------------------------------------------------------------------------
A1DAU4_NEOFI/241-329--------------------------------------------------------------------------------
B8NI41_ASPFN/244-334--------------------------------------------------------------------------------
B0D1K5_LACBS/216-304--------------------------------------------------------------------------------
Q0CB16_ASPTN/235-323--------------------------------------------------------------------------------
Q0CB78_ASPTN/235-323--------------------------------------------------------------------------------
A5BHD5_VITVI/183-271--------------------------------------------------------------------------------
WAXS4_ARATH/175-263--------------------------------------------------------------------------------
B0D1K6_LACBS/216-303--------------------------------------------------------------------------------
B0DRX8_LACBS/207-292--------------------------------------------------------------------------------
B6QRT0_PENMQ/256-344--------------------------------------------------------------------------------
B8P281_POSPM/564-647--------------------------------------------------------------------------------
C5GEJ3_AJEDR/220-310--------------------------------------------------------------------------------
B0D1K7_LACBS/218-306--------------------------------------------------------------------------------
B0DA43_LACBS/265-345--------------------------------------------------------------------------------
D1LC97_9HYPO/252-340--------------------------------------------------------------------------------
Q96W92_GIBZA/251-341--------------------------------------------------------------------------------
B6HN05_PENCW/246-334--------------------------------------------------------------------------------
Q2US74_ASPOR/254-342--------------------------------------------------------------------------------
Q2UE90_ASPOR/249-338--------------------------------------------------------------------------------
C5P066_COCP7/258-347--------------------------------------------------------------------------------
C5PCP4_COCP7/167-251--------------------------------------------------------------------------------
B0Y9M2_ASPFC/246-333--------------------------------------------------------------------------------
C4JIX8_UNCRE/259-348--------------------------------------------------------------------------------
C7ZCA2_NECH7/246-334--------------------------------------------------------------------------------
B6H3A9_PENCW/233-321--------------------------------------------------------------------------------
A2QRU6_ASPNC/230-318--------------------------------------------------------------------------------
A8NTB7_COPC7/251-331--------------------------------------------------------------------------------
ASAT1_ARATH/180-267--------------------------------------------------------------------------------
A1C4D4_ASPCL/251-338--------------------------------------------------------------------------------
B6HRC6_PENCW/265-351--------------------------------------------------------------------------------
C5FXZ8_ARTOC/242-330--------------------------------------------------------------------------------
Q0CDC3_ASPTN/224-312--------------------------------------------------------------------------------
WAXS5_ARATH/175-263--------------------------------------------------------------------------------
C6TIL0_SOYBN/192-280--------------------------------------------------------------------------------
A1D2V2_NEOFI/225-313--------------------------------------------------------------------------------
A1DC18_NEOFI/245-333--------------------------------------------------------------------------------
B6HKP3_PENCW/224-312--------------------------------------------------------------------------------
Q0CS68_ASPTN/137-225--------------------------------------------------------------------------------
B6HN85_PENCW/288-374--------------------------------------------------------------------------------
D4DFW4_TRIVH/660-754--------------------------------------------------------------------------------
D4DK35_TRIVH/255-353--------------------------------------------------------------------------------
A1DEF4_NEOFI/254-338--------------------------------------------------------------------------------
B0CVR7_LACBS/274-353--------------------------------------------------------------------------------
B8NF28_ASPFN/25-113--------------------------------------------------------------------------------
B6H8B2_PENCW/235-322--------------------------------------------------------------------------------
B8M887_TALSN/166-252--------------------------------------------------------------------------------
Q6Q889_LEPMC/242-327--------------------------------------------------------------------------------
Q0CRW1_ASPTN/238-326--------------------------------------------------------------------------------
Q5KNT5_CRYNJ/307-391--------------------------------------------------------------------------------
Q0C7G9_ASPTN/642-728--------------------------------------------------------------------------------
C9SDD4_VERA1/226-317--------------------------------------------------------------------------------
B9HCG3_POPTR/129-219--------------------------------------------------------------------------------
B6QWC0_PENMQ/779-867--------------------------------------------------------------------------------
D4AQU2_ARTBC/243-333--------------------------------------------------------------------------------
C5FGQ3_ARTOC/253-336--------------------------------------------------------------------------------
C5XF80_SORBI/188-267--------------------------------------------------------------------------------
Q0UA02_PHANO/249-339--------------------------------------------------------------------------------
C5JC80_AJEDS/224-314--------------------------------------------------------------------------------
B6HGV9_PENCW/239-312--------------------------------------------------------------------------------
C5P323_COCP7/246-336--------------------------------------------------------------------------------
D4DL18_TRIVH/237-325--------------------------------------------------------------------------------
Q0ULA5_PHANO/246-323--------------------------------------------------------------------------------
A6SHP6_BOTFB/195-284--------------------------------------------------------------------------------
B2W4U1_PYRTR/280-366--------------------------------------------------------------------------------
Q11QG1_CYTH3/167-243--------------------------------------------------------------------------------
B7G275_PHATC/248-337--------------------------------------------------------------------------------
A3ZXR5_9PLAN/169-248--------------------------------------------------------------------------------
A7ETV0_SCLS1/27-116--------------------------------------------------------------------------------
A1CLH2_ASPCL/277-368--------------------------------------------------------------------------------
A1D5T3_NEOFI/290-381--------------------------------------------------------------------------------
A9B779_HERA2/181-260--------------------------------------------------------------------------------
A2R9E5_ASPNC/443-536--------------------------------------------------------------------------------
C4JNF5_UNCRE/338-429--------------------------------------------------------------------------------
B6HMX5_PENCW/331-421--------------------------------------------------------------------------------
A1C9Z9_ASPCL/340-433--------------------------------------------------------------------------------
D4ASB5_ARTBC/344-439--------------------------------------------------------------------------------
A9B206_HERA2/178-253--------------------------------------------------------------------------------
C7YGR5_NECH7/341-430--------------------------------------------------------------------------------
A6RHB9_AJECN/147-239--------------------------------------------------------------------------------
C5GAL9_AJEDR/357-446--------------------------------------------------------------------------------
Q0UFW4_PHANO/200-286--------------------------------------------------------------------------------
C5FVY5_ARTOC/341-437--------------------------------------------------------------------------------
B8MBR3_TALSN/324-425--------------------------------------------------------------------------------
Q0HJ90_SHESM/25-98--------------------------------------------------------------------------------

PF03062

YA71_SCHPO/187-531GPIISFNNFMSQMK.YPTVSTLKY..................RNLLYAIRFLVC....VLTMEFLLHYAYVTAISKDGNW
MBOA7_HUMAN/218-419GPTLQCPPPSSPEK.AASLEYDYE................................................TIRNIDCY
PORCN_HUMAN/115-402GPWISFHSYLQAVQ.GRPLSCRWLQK.............VARSLALALLCLVLSTCVGPYLFPYFIPLNGDRLLRNKKRK
MBOA7_CAEEL/100-411GPYYTYQMLIDSQN.PILKSWDPT.................LEVKSRFVRLLWS....VPVFVITNHYFPLDILRSDAIW
MBOA5_MOUSE/126-437GPQFSMNHYMKLVR.GQLTDI...PG.............KMPNSTIPALKRLSLGLVYLVGYTLLSPHITDDYLLTEDYD
O18241_CAEEL/167-455....RFEDFIQQFE.TWQKTTEICWN.............SVKCALWFGFRLVFW....FGFIELILHFIHVQALFNSPDS
O01925_CAEEL/102-410GPQFTLSKFRSFVNGDWLDSDGQPP................KSAFLPSIGRFLAGCTYMVLHQWGQFWIPDQYFNSDAYN
ARE1_YEAST/202-609SPETR.EILQKSCD.FCLFELNYQTKDNDFPNNISCSNFFMFCLFPVLVYQINYPRTSRIRWRYVLEKVCAIIGTIFLMM
ARE2_YEAST/215-641GALEKSCEFCSFEL.SSQSLSDQTQKFPNNI...SAKSFFWFTMFPTLIYQIEYPRTKEIRWSYVLEKICAIFGTIFLMM
AREH1_SCHPO/188-536.PSLVYS..MEFPR.VAHFRWHYMA...............FKAGSTFGLLALTLALVDWYFVP...SAVAVKDLDFIGKL
Q17498_CAEEL/120-435.PSFIYRDSYPRTE.KRDMKAAGLY...................FLECLAVIE..FVNLTFTQWVFPWLHVQDYTSLSFS
SOAT1_HUMAN/171-520APTLIYRD..SYPR.NPTVRWGY.....................VAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFS
SOAT2_HUMAN/149-494.PTLIYRE..TYPR.TPYVRWNYVA................K.NFAQALGCV....LYACFILGRLCVPVFANMSREPFS
DGAT1_HUMAN/153-474APTLCYE..LNFPR.SPRIRKRF....................LLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDM
DLTB_BACSU/102-391GPIDRYRRFVKDEQ...........................KAWTKEEYADLLYTGIHKIFIGFLYKFIIGYAINTYFIM
Q53662_STAAU/117-404GPIDRYKRFVKDDK.KVPTGNEYR..................ELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDL..
Q9X2N5_STAXY/117-404GPIDRYKRFVKDES.KIQSSESYR..................ASLNKAIHFIMLGFLYKYIIAYLIQVYAINPLMLDF..
Q9S390_LISMN/99-390GPIDRFRRFKKDVD.NPPSKEAYL..................ALLNRGIFLIFLGFLYKFIIAYLVNKHFVVPLDIAITH
DLTB_LACRH/103-398GPIDRYRRFVKDYD.RVPDPEHYA..................QLVTKAIHYLMLGFLYKFILGYIFGTLWLPSVEHMAMA
Q9CG50_LACLA/100-390GPIDRFRRFVKELK.APVVTEKYL..................DLLNKGVFRIFQGFLYKFIIGYLIDQYWLHGIAISATI
O68577_STRMU/108-400GPIDRFRRFNDDYE.KIPDKDELL..................DMLEQSVHYIMLGFFYKFVLAQILGTMILPGLKEMALQ
Q97N83_STRPN/106-398GPIDRFKRFNENYQ.AIPERDELM..................DMLDESVRYIMWGFLYKFILAHVLGETLLPPLKNLALQ
Q99ZA7_STRP1/108-400GPIDRFRHFQEDYH.KLPERDDYF..................AMLNKAVMYLMLGFLYKHIISYCLGGILLPLLENKALM
O25526_HELPY/120-426GPIVHHSEMMPQFK.DKNNQYLNY..................RNIALGLFIFSIGLFKKVVIADNTAHFADFGFDKATSL
Q9ALT7_CAMJU/111-405GPIVHHKEMMPQFH.SLLNKEKALI...............DWKLIAKGLFIFSIGLFKKVYIADSFASWANAGFTVVQNG
ALGI_AZOVI/108-385GPVLRFRDLVDQFN.HRTHTLDKF.....................AEGCTRFMQGFIKKVFIADSLAPIADHCFALSD..
Q97IS6_CLOAB/110-386GPISRYVKVGEQIK.NREHSWQKF.....................SVGACRFITGLGKKVLISNSVSIIADKVFTMNTNG
O83577_TREPA/112-399GPIANASHFFTRLP.HNLRAGESPLD..............RPIHFDRAVVLLYTGLVKKVIFADFLSILVTDKIFTLPSA
GUP2_YEAST/202-559GPIITFNDYLYQSE.NKLPSLTKK.....................NIGFYALKV.FSSLLLMEIILHYIYVGAIARTKAW
GUP1_YEAST/170-510GPIITFNDYVYQSK.HTLPSINFK..................FIFYYAVRFVIA....LLSMEFILHFLHVVAISKTKAW
Q9C693_ARATH/108-343G...LWRELSP.....................................VEIFIVGY.......GVLNFMWLKFLLLWR..
HHAT_HUMAN/125-442GPILSFSEFIKQMQ.QQEHDS.......................LKASLCVLALGLG.RLLCWWWLAELMAHLMYMHAIY
HHAT_DROME/127-444GPIISYQRFAARRE.DEVQNWLGFV................GGVLRSAIWWLVM....QCALHYFYIHYMSRDVRMVEMM
NESSY_DROME/114-421GPQFPFRRYKAFVD.GEFRQHE....................GNVEAGVRRFGAGAFYLIVCQVGLRYLPDSYFLTPEFA
ALE1_SCHPO/114-426GPAFDYVDYERFIT.LSMFKPLADPYEK..........QITPHSLEPALGRCWRGLLWLILFITGSSIYPLKFLLTPKFA
ALE1_YEAST/111-445GPSFDYADFDSWLN.CEMFRDLPESKKPMR......RHHPGERRQIPKNGKLALWKVVQGLAWMILSTLGMKHFPVKYVL
Q9CAN8_ARATH/104-417GPVFEMKDYLEWTE.EKGIWAVSEKG.............KRPSPYGAMIRAVFQAAICMALYLYLVPQFPLTRFTEPVYQ
Q9XUB0_CAEEL/123-366GPTNHYSNWSAYLD.LKLVPKFERTG.............RPFDSTSTVFEKFKVAIALSSFCSALYSLLPIPLTKYPTIS
Q9VMD5_DROME/93-427GPYYRYRTYRDYFE.MPFKTYAPTVEA...........TLEKLKYAVFYCALYLATNYMWPLDYALSDEFFNDRSFVYRL
Q9I935_XENLA/115-402GPWTSFSSYLQAVK.GQRLSISWLWR.............VSRSLALSILCLLMSTCVSPYLFPYFIPLYGDQLLRNKKHK
PORCN_DROME/126-459GPWVSFGCYMDCLV.PRNSWLVSLRR..............LLPNVVICVLAVTVSNCVAPALSDFFGDSSHFLVMYWDAL

PF13813

Q5B2E7_EMENI/234-322--------------------------------------------------------------------------------
Q5B9S2_EMENI/238-325--------------------------------------------------------------------------------
Q5AR60_EMENI/251-335--------------------------------------------------------------------------------
Q5BD08_EMENI/258-345--------------------------------------------------------------------------------
Q5BB23_EMENI/325-418--------------------------------------------------------------------------------
A8N7P7_COPC7/230-318--------------------------------------------------------------------------------
A8N7Q6_COPC7/205-291--------------------------------------------------------------------------------
A8N7W1_COPC7/216-300--------------------------------------------------------------------------------
YNV5_SCHPO/228-305--------------------------------------------------------------------------------
B0DN88_LACBS/223-307--------------------------------------------------------------------------------
B0CTS2_LACBS/198-285--------------------------------------------------------------------------------
B0CP14_LACBS/223-309--------------------------------------------------------------------------------
B8PNC8_POSPM/221-304--------------------------------------------------------------------------------
B0DP95_LACBS/215-299--------------------------------------------------------------------------------
B0DPA1_LACBS/215-299--------------------------------------------------------------------------------
B8PN91_POSPM/156-242--------------------------------------------------------------------------------
B0D1K8_LACBS/215-302--------------------------------------------------------------------------------
A1DAU4_NEOFI/241-329--------------------------------------------------------------------------------
B8NI41_ASPFN/244-334--------------------------------------------------------------------------------
B0D1K5_LACBS/216-304--------------------------------------------------------------------------------
Q0CB16_ASPTN/235-323--------------------------------------------------------------------------------
Q0CB78_ASPTN/235-323--------------------------------------------------------------------------------
A5BHD5_VITVI/183-271--------------------------------------------------------------------------------
WAXS4_ARATH/175-263--------------------------------------------------------------------------------
B0D1K6_LACBS/216-303--------------------------------------------------------------------------------
B0DRX8_LACBS/207-292--------------------------------------------------------------------------------
B6QRT0_PENMQ/256-344--------------------------------------------------------------------------------
B8P281_POSPM/564-647--------------------------------------------------------------------------------
C5GEJ3_AJEDR/220-310--------------------------------------------------------------------------------
B0D1K7_LACBS/218-306--------------------------------------------------------------------------------
B0DA43_LACBS/265-345--------------------------------------------------------------------------------
D1LC97_9HYPO/252-340--------------------------------------------------------------------------------
Q96W92_GIBZA/251-341--------------------------------------------------------------------------------
B6HN05_PENCW/246-334--------------------------------------------------------------------------------
Q2US74_ASPOR/254-342--------------------------------------------------------------------------------
Q2UE90_ASPOR/249-338--------------------------------------------------------------------------------
C5P066_COCP7/258-347--------------------------------------------------------------------------------
C5PCP4_COCP7/167-251--------------------------------------------------------------------------------
B0Y9M2_ASPFC/246-333--------------------------------------------------------------------------------
C4JIX8_UNCRE/259-348--------------------------------------------------------------------------------
C7ZCA2_NECH7/246-334--------------------------------------------------------------------------------
B6H3A9_PENCW/233-321--------------------------------------------------------------------------------
A2QRU6_ASPNC/230-318--------------------------------------------------------------------------------
A8NTB7_COPC7/251-331--------------------------------------------------------------------------------
ASAT1_ARATH/180-267--------------------------------------------------------------------------------
A1C4D4_ASPCL/251-338--------------------------------------------------------------------------------
B6HRC6_PENCW/265-351--------------------------------------------------------------------------------
C5FXZ8_ARTOC/242-330--------------------------------------------------------------------------------
Q0CDC3_ASPTN/224-312--------------------------------------------------------------------------------
WAXS5_ARATH/175-263--------------------------------------------------------------------------------
C6TIL0_SOYBN/192-280--------------------------------------------------------------------------------
A1D2V2_NEOFI/225-313--------------------------------------------------------------------------------
A1DC18_NEOFI/245-333--------------------------------------------------------------------------------
B6HKP3_PENCW/224-312--------------------------------------------------------------------------------
Q0CS68_ASPTN/137-225--------------------------------------------------------------------------------
B6HN85_PENCW/288-374--------------------------------------------------------------------------------
D4DFW4_TRIVH/660-754--------------------------------------------------------------------------------
D4DK35_TRIVH/255-353--------------------------------------------------------------------------------
A1DEF4_NEOFI/254-338--------------------------------------------------------------------------------
B0CVR7_LACBS/274-353--------------------------------------------------------------------------------
B8NF28_ASPFN/25-113--------------------------------------------------------------------------------
B6H8B2_PENCW/235-322--------------------------------------------------------------------------------
B8M887_TALSN/166-252--------------------------------------------------------------------------------
Q6Q889_LEPMC/242-327--------------------------------------------------------------------------------
Q0CRW1_ASPTN/238-326--------------------------------------------------------------------------------
Q5KNT5_CRYNJ/307-391--------------------------------------------------------------------------------
Q0C7G9_ASPTN/642-728--------------------------------------------------------------------------------
C9SDD4_VERA1/226-317--------------------------------------------------------------------------------
B9HCG3_POPTR/129-219--------------------------------------------------------------------------------
B6QWC0_PENMQ/779-867--------------------------------------------------------------------------------
D4AQU2_ARTBC/243-333--------------------------------------------------------------------------------
C5FGQ3_ARTOC/253-336--------------------------------------------------------------------------------
C5XF80_SORBI/188-267--------------------------------------------------------------------------------
Q0UA02_PHANO/249-339--------------------------------------------------------------------------------
C5JC80_AJEDS/224-314--------------------------------------------------------------------------------
B6HGV9_PENCW/239-312--------------------------------------------------------------------------------
C5P323_COCP7/246-336--------------------------------------------------------------------------------
D4DL18_TRIVH/237-325--------------------------------------------------------------------------------
Q0ULA5_PHANO/246-323--------------------------------------------------------------------------------
A6SHP6_BOTFB/195-284--------------------------------------------------------------------------------
B2W4U1_PYRTR/280-366--------------------------------------------------------------------------------
Q11QG1_CYTH3/167-243--------------------------------------------------------------------------------
B7G275_PHATC/248-337--------------------------------------------------------------------------------
A3ZXR5_9PLAN/169-248--------------------------------------------------------------------------------
A7ETV0_SCLS1/27-116--------------------------------------------------------------------------------
A1CLH2_ASPCL/277-368--------------------------------------------------------------------------------
A1D5T3_NEOFI/290-381--------------------------------------------------------------------------------
A9B779_HERA2/181-260--------------------------------------------------------------------------------
A2R9E5_ASPNC/443-536--------------------------------------------------------------------------------
C4JNF5_UNCRE/338-429--------------------------------------------------------------------------------
B6HMX5_PENCW/331-421--------------------------------------------------------------------------------
A1C9Z9_ASPCL/340-433--------------------------------------------------------------------------------
D4ASB5_ARTBC/344-439--------------------------------------------------------------------------------
A9B206_HERA2/178-253--------------------------------------------------------------------------------
C7YGR5_NECH7/341-430--------------------------------------------------------------------------------
A6RHB9_AJECN/147-239--------------------------------------------------------------------------------
C5GAL9_AJEDR/357-446--------------------------------------------------------------------------------
Q0UFW4_PHANO/200-286--------------------------------------------------------------------------------
C5FVY5_ARTOC/341-437--------------------------------------------------------------------------------
B8MBR3_TALSN/324-425--------------------------------------------------------------------------------
Q0HJ90_SHESM/25-98--------------------------------------------------------------------------------

PF03062

YA71_SCHPO/187-531NQYSAVESAMISFIVLFMTWLKLLIP....WRLFRL.WSLIDDIE...................................
MBOA7_HUMAN/218-419S...............................................................................
PORCN_HUMAN/115-402ARGTMVRWLRAYESAVSFHFSNY....FVGFLSEATATLAGAGFTEEK...........................DHLEW
MBOA7_CAEEL/100-411EVSFFTRLVYAALIFVVFKTRVYSAW......AIAESICVILGIGIYPAASNPKIIMGPTDLNAFDKLKTRENIEMSSDA
MBOA5_MOUSE/126-437N......RPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILSGLGFNGFDE.....................NGTVRWDA
O18241_CAEEL/167-455LVNSLNSYEVSAIAYVA............GQ.LFHVKYVVIFGVPAFF...........................AALDG
O01925_CAEEL/102-410NLSFFWRWSWVTLWFRLTMYKYCAMW......LITEGASILSGLGHNGKDA.....................EGNDRWDG
ARE1_YEAST/202-609VTAQFFMHPVAMRCIQFHNTPTFGGWIPATQEWFHLLFDMIPGFTVLYMLTFYMIW............DALLNCVAELTR
ARE2_YEAST/215-641IDAQILMYPVAMRALAVRNSEWTGILDRL.LKWVGLLVDIVPGFIVMYILDFYLIW............DAILNCVAELTR
AREH1_SCHPO/188-536RIAPLLMNKIMFPAIILYLIMFYLIFDCILNAFAEITKFADRGF....................................
Q17498_CAEEL/120-435TIALSLFTGIIPGIICM....................TSLFYGLLHCWLN.......................CFSEMMQ
SOAT1_HUMAN/171-520AR..VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFG.....................................
SOAT2_HUMAN/149-494TRALVL..SILHATLPGIFMLLLIFFAFLHCWLNAFAEMLRFG.....................................
DGAT1_HUMAN/153-474DYSRIIERLLKLAVPNHLIWLIFFYWLFHS.CLNAVAELMQFG.....................................
DLTB_BACSU/102-391NLPAITHNKILGNLLYMYGYSMYLFFDFAGYTMFAVGVSYIMGIK...................................
Q53662_STAAU/117-404.......HGFVNLWLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIK...................................
Q9X2N5_STAXY/117-404.......SNFTAKCLYMYAYSLYLFFDFAGYSLFAMAFSYLYGIQ...................................
Q9S390_LISMN/99-390NV.....DTTKSLIGYMYAYSMYLFFDFAGYSAFAVGVSYLLGVQ...................................
DLTB_LACRH/103-398SRGGAFLGLSWPVVGVMYAYSGYLFFDFAGYSLFAVAISYLMGIE...................................
Q9CG50_LACLA/100-390H......PSFLNVSSSMYAYGLYLFFDFAGYSLFAIGVSNLMGYD...................................
O68577_STRMU/108-400KGG....WFNWPTLGVMYVYGLDLFFDFAGYSMFAIAISNFMGIK...................................
Q97N83_STRPN/106-398SGG....FFNLYALAVMYTFGLELFFDFAGYSMFALAISNLMGIR...................................
Q99ZA7_STRP1/108-400VGG....YFNKETILVMYVYGLNLFFDFAGYSMFAIGISYLLGIR...................................
O25526_HELPY/120-426S........FIQAWMTSLSYSFQLYFDFSGYCDMAIG....IGLFF................................NI
Q9ALT7_CAMJU/111-405NF.....LNIFEAWATSLSYTFQLYFDFSGYCDMAIGLALFFGI....................................
ALGI_AZOVI/108-385.......PTTGDAWLGALAYTAQLYFDFSGYSDMAIGLGLMIGFRF.................................M
Q97IS6_CLOAB/110-386P......VPVTLAWLGSIAYTIQIFFDFSGYSDMVIGLGLMFGFKI.................................D
O83577_TREPA/112-399.......YSSTELLFGLISYSAVLYCDFSGYSDLAIAVGLLFGFE...................................
GUP2_YEAST/202-559NNDTPLQQAMIALFNLNIMYLKLLIP....WRLFRL.WAMVDGID...................................
GUP1_YEAST/170-510ENDTPFQISMIGLFNLNIIWLKLLIP....WRLFRL.WALLDGID...................................
Q9C693_ARATH/108-343..............................YFRF...WSLVNGIET.................................V
HHAT_HUMAN/125-442SSIPL.LETVSCWTLGGLALAQVLFF....Y....VKYLVLFGVPALL...........................MRLDG
HHAT_DROME/127-444.......DSVFWQHSAGYFMGQFFFL....YYVVTYG....LGIAFA.............................VQDG
NESSY_DROME/114-421QVSFVKRIYLLGFWAKFSLYKYISCW......LLTEGALICIGLTYKGEDK.....................NGQPDWSG
ALE1_SCHPO/114-426SSPILLKYGYVCITAFVARMKYY......GAWELSDGACILSGIGYNGLDS.....................SKHPRWDR
ALE1_YEAST/111-445DKDGFPTRSFIFRIHYLFLLGFIHRFKYYAAWTISEGSCILCGLGYNGYDSK....................TQKIRWDR
Q9CAN8_ARATH/104-417EWGFLKRFGYQYMAGFTARWKYYFIW......SISEASIIISGLGFSGWTDE...................TQTKAKWDR
Q9XUB0_CAEEL/123-366E.............................YNLLS.............................................
Q9VMD5_DROME/93-427LYVWPTFFTFRARIYTGLTLSECV.CTMAGFGAYPDESDPNNGEGPRKRYQHLK...............RDADKHTYNFT
Q9I935_XENLA/115-402ARGLAVRWLRAYENTSPFHFSNY....FVGFLSEVTAVLSGVGFSEEK...........................DHVRW
PORCN_DROME/126-459SVRSSHYFVGMMAQALLVASDQRL..D..G....ATKESDMLGPLI.................................S

PF13813

Q5B2E7_EMENI/234-322-FP.P.LFNK...M....TDA.....Y...T.....LRN.....FWGK.FW..HQILRV....DFTA....V....S...
Q5B9S2_EMENI/238-325-WP.P.LFGS...I....HDA.....Y...T.....VRG.....FWGK.TW..HQNVRW....PLTS....C....S...
Q5AR60_EMENI/251-335-WP.S.LFGN...M....RDL.....Y...T.....VRN.....FWGR.VW..HQIFRQ....IFTR....C....G...
Q5BD08_EMENI/258-345-WP.P.VAGS...L....SEA.....W...T.....LSR.....LWGQ.AW..HQTLRR....PLAS....N....A...
Q5BB23_EMENI/325-418-YT.D.QFGP...I....TAI.....LD.DG.....LAG.....AWGK.WW..HQIFRF....GFVS....T....A...
A8N7P7_COPC7/230-318-WP.F.MYGS...V....WEG.....Y...T.....VRR.....CWSK.VW..HQNMKR....FMMA....H....T...
A8N7Q6_COPC7/205-291-WP.Y.LFGE...V....GEA.....W...S.....VSG.....CWNR.FW..HQVMRG....HLKS....N....S...
A8N7W1_COPC7/216-300-WP.Q.VMGN...P....LDA.....Y...T.....VRR.....AWGR.VW..HQALRR....TLTSNADVV....A...
YNV5_SCHPO/228-305-YP.L.MMGN...V....SKT.....T...S.....VND.....FWSR.DW..HVCTKP....YFRV....I....A...
B0DN88_LACBS/223-307-WP.D.LFGS...P....FDA.....Y...S.....VQR.....FWGR.TW..HQVLRR....PLKS....C....T...
B0CTS2_LACBS/198-285-WP.D.LFGS...P....FNA.....Y...S.....VQR.....FWGR.TW..HQMLRR....PLKS....C....A...
B0CP14_LACBS/223-309-WP.D.LFGS...P....FDA.....Y...S.....VQR.....FWGY.A....DVASG....IAS..........T...
B8PNC8_POSPM/221-304-WP.T.VYGE...W....ADA.....Y...T.....LRR.....FWGR.TY..HQLLRR....YAAS....M....G...
B0DP95_LACBS/215-299-WP.P.FFGY...I....GDA.....Y...T.....VRR.....SWGR.VW..HQVMRR....FLQVECDFI....A...
B0DPA1_LACBS/215-299-WP.H.LFGY...V....GDA.....Y...T.....VRR.....SWGR.VW..HQLLRR....FLQV....E....S...
B8PN91_POSPM/156-242-WP.Q.VYGN...W....ADS.....Y...T.....VRR.....FWGR.TY..HQNFRR....CTAA....V....G...
B0D1K8_LACBS/215-302-WP.P.LFGY...L....GDA.....Y...T.....VRR.....SWGR.VW..HQLMRR....FLQVESDFL....A...
A1DAU4_NEOFI/241-329-WP.P.LFGR...A....KQA.....Y...T.....LRN.....FWGT.YW..HQMFRW....PFTA....T....S...
B8NI41_ASPFN/244-334-WP.P.LFGK...L....KEA.....T...T.....VRN.....FWGT.FW..HQMLRK....SLST....I....T...
B0D1K5_LACBS/216-304-WP.A.IFGY...W....SDA.....Y...T.....VGR.....FWGR.FW..HQNFRR....FVTA....H....G...
Q0CB16_ASPTN/235-323-CP.P.LYGP...I....TEA.....Y...T.....IRQ.....FWGV.SW..HQCLRR....GLAG....H....A...
Q0CB78_ASPTN/235-323-WP.P.LFGS...M....WDA.....Y...T.....LRN.....FWGK.FW..HQFLRW....PFTS....M....S...
A5BHD5_VITVI/183-271-LE.P.QFNE...P....YLA.....T...S.....LQD.....FWGR.RW..NLMVSS....ILRP....T....I...
WAXS4_ARATH/175-263-LE.P.HFNE...P....YLS.....T...S.....LQD.....FWGR.RW..NLMVPA....ILRP....A....V...
B0D1K6_LACBS/216-303-WP.A.MFGS...W....SEA.....Y...T.....IGR.....FWGR.TW..HQMLRR....LLTV....H....A...
B0DRX8_LACBS/207-292-WP.N.FFGP...W....LRT.....T...T.....VRR.....FWGK.SW..HQMMRR....PVTG....A....G...
B6QRT0_PENMQ/256-344-WR.P.LFGR...V....SEI.....Y...S.....LRQ.....FWGT.FW..HQNLRRMISEPVEF....L....A...
B8P281_POSPM/564-647-WP.D.VYGN...W....ADA.....Y...T.....VRR.....FWGR.TY..HQYFRR....HTAF....V....G...
C5GEJ3_AJEDR/220-310-WP.P.LFNS...M....WDA.....Y...T.....LRN.....YWGK.FW..HQMLRW....PFTS....I....S...
B0D1K7_LACBS/218-306-WP.P.IFGH...W....SEA.....F...T.....VGR.....YWGR.TW..HQVLRR....LLTA....H....G...
B0DA43_LACBS/265-345-WP.P.VFHA...P....WFA.....T...S.....LND.....FWSR.RW..HQIFRD....SFVS....F....G...
D1LC97_9HYPO/252-340-WP.P.LFGS...I....WDA.....Y...T.....IRG.....FWST.FW..HSYCRW....TLTT....I....S...
Q96W92_GIBZA/251-341-WP.P.VFGS...I....LDA.....Y...T.....IRG.....FWGT.FW..HQYFRR....ALTG....V....S...
B6HN05_PENCW/246-334-CP.P.LYGP...L....SEA.....Y...S.....IRH.....FWGV.TW..HQCLRR....GLTG....H....A...
Q2US74_ASPOR/254-342-WP.P.VANS...L....TEA.....W...S.....LTR.....LWGT.AW..HQVLRT....LLVS....N....A...
Q2UE90_ASPOR/249-338-WP.P.FYGS...P....LEA.....Y...S.....LRR.....FWGV.FW..HQTNTH....KFNS....I....S...
C5P066_COCP7/258-347-WP.L.MYGR...I....SDA.....W...S.....VRR.....FWGL.VW..HQQLRRPLVSYSDL....L....T...
C5PCP4_COCP7/167-251-WP.S.LFGN...I....ADA.....W...T.....VRR.....FWGR.FW..HRIATPTLSQWTRI....I....I...
B0Y9M2_ASPFC/246-333-WP.P.VFGN...V....SDM.....Y...S.....LTR.....VWGI.AW..HQILRK....LVTS....N....ADIL
C4JIX8_UNCRE/259-348-WP.T.LFGH...I....SDA.....W...S.....IRQ.....FWSV.AW..HQYFRRSFVCYSEF....I....A...
C7ZCA2_NECH7/246-334-WP.P.LFGS...M....WDA.....Y...T.....IRG.....FWNT.FW..HQDCLW....PMKS....L....S...
B6H3A9_PENCW/233-321-CP.P.LYGR...A....LDA.....D...T.....VRG.....FWGK.FW..HQLLQN....PLTS....V....S...
A2QRU6_ASPNC/230-318-WP.P.EFGS...L....ADT.....Y...T.....VRG.....FWGK.FW..HQNLRW....SYTG....V....S...
A8NTB7_COPC7/251-331-WP.P.AFDK...P....WVA.....T...S.....LNE.....FWAK.RW..HQSFRD....IFVG....V....G...
ASAT1_ARATH/180-267-LE.P.QFNK...P....YLA.....T...S.....LQD.....FWGR.RW..NLMVTG....ILRP....T....V...
A1C4D4_ASPCL/251-338-WP.P.IFGE...V....GEM.....Y...S.....LTR.....VWGI.AW..HQILRQ....LITS....N....A...
B6HRC6_PENCW/265-351-WQ.P.LFGS...V....GEA.....Y...G.....VRR.....FWAK.FW..HQLTTP....CCAS....S....G...
C5FXZ8_ARTOC/242-330-WP.P.YYGS...L....SQA.....F...S.....LRQ.....VWAV.FW..HQANAA....KFAS....M....S...
Q0CDC3_ASPTN/224-312-WP.P.FYGA...P....YQA.....Y...T.....MRR.....YWSQ.AW..HQSNTH....KFKT....ISDYVA...
WAXS5_ARATH/175-263-LE.P.QSNK...P....YLA.....T...S.....LQD.....FWGR.RW..NLMVPA....ILRP....A....V...
C6TIL0_SOYBN/192-280-LP....SDD...P....YLS.....T...S.....LRD.....FWGR.RW..NLIVTY....TLRH....T....V...
A1D2V2_NEOFI/225-313-WT.P.LFGS...P....LQA.....Y...S.....IRR.....FWTK.FW..HRLAVA....PCVS....S....G...
A1DC18_NEOFI/245-333-CR.P.GFGR...V....RDA.....C...T.....IRG.....FWGK.FW..HQSFRW....PLTS....V....G...
B6HKP3_PENCW/224-312-SP.P.IIGR...M....ADI.....Y...T.....LRN.....YWGK.FW..HQLLRL....PLTS....T....S...
Q0CS68_ASPTN/137-225-WP.P.LFGS...I....TEA.....H...T.....LRR.....FWAN.FW..HQLFRW....PMQG....L....S...
B6HN85_PENCW/288-374-WP.A.LFGN...P....MDA.....S...S.....VRG.....FWAQ.FW..HQLTIPTYVYYSRV....V....S...
D4DFW4_TRIVH/660-754-WP.P.LFGK...L....KEA.....T...T.....VRN.....FWASPSWLNRQLTSQ...KSLST....I....T...
D4DK35_TRIVH/255-353-WP.P.FFGP...L....TRL.....Y...S.....IRN.....LWGM.VW..HRQLRV....LLVD....Y....S...
A1DEF4_NEOFI/254-338-WP.G.LFGS...P....ADL.....Y...T.....IRN.....FWGR.VW..HQIFRH....MFTR....S....G...
B0CVR7_LACBS/274-353-WP.P.VMDN...P....WSA.....D...S.....MHS.....FWAK.HW..HQLLRQ....TFLV....F....G...
B8NF28_ASPFN/25-113-WQ.P.LFGS...P....LQA.....C...S.....IRR.....FWTK.FW..HRLTVS....CCAS....S....G...
B6H8B2_PENCW/235-322-WP.P.LFGH...L....SQA.....V...G.....LRN.....FWSR.FW..HTLPMK....PYRS....I....G...
B8M887_TALSN/166-252-CR.P.RFGD...F....WKA.....Y...T.....VRA.....FWGV.CW..HQDFRW....LLHQ....T....A...
Q6Q889_LEPMC/242-327-CP.S.AFGD...L....EDF.....F...T.....VRK.....AWST.VW..HQHMRR....LTST....M....G...
Q0CRW1_ASPTN/238-326-WP.P.LFNS...T....LDA.....W...T.....LRR.....FWGL.YW..HQWLRW....PFTA....M....A...
Q5KNT5_CRYNJ/307-391-WEVD.LFDN...P....LAA.....D...S.....LLD.....FWGR.RW..HQFFRH....QFMM....L....S...
Q0C7G9_ASPTN/642-728-YP.P.LFRS...PR..AMLT.....C...R.....LRD.....IWGR.MW..HDLCRR....PLLA....T....S...
C9SDD4_VERA1/226-317-WP.P.LYGS...P....LKA.....Y...S.....LRH.....FWGA.FW..HKIGST....SQAI....W....G...
B9HCG3_POPTR/129-219-LV.T.LFNK...P....YLA.....T...S.....LQD.....FWGR.RW..NRLSSN....ILRQ....T....I...
B6QWC0_PENMQ/779-867-WP.P.IFGS...L....SNA.....S...S.....MRN.....FWGK.FW..HRILVR....PYEN....Y....S...
D4AQU2_ARTBC/243-333-SP.P.LFGP...V....YTA.....S...S.....LAS.....FWSE.TW..HTAFAS....PCRS....L....A...
C5FGQ3_ARTOC/253-336-WP.P.YFGP...L....TEL.....Y...S.....IRN.....FWSF.FI.THSILRL....PLAK....T....V...
C5XF80_SORBI/188-267-LE.R.QFNA...P....LAV.....A...S.....LNG.....FWGR.QW..NLMAVD....LLRE....S....A...
Q0UA02_PHANO/249-339-WSMS.LFGH...I....SEA.....Y...T.....VRR.....YWGK.HW..HNYIYA....SFNG....H....T...
C5JC80_AJEDS/224-314-SP.P.LFGP...L....YSA.....T...S.....LST.....FWSE.TW..HSAFAS....PCRS....L....A...
B6HGV9_PENCW/239-312-WP.P.AFGR...M....ADA.....F...T.....LRN.....FWAN.F.....IARD....VLR..............
C5P323_COCP7/246-336-SP.P.LFGP...V....YTA.....T...S.....LSS.....FWSE.TW..HSAFAS....PCHS....L....A...
D4DL18_TRIVH/237-325-WP.W.LWGS...P....GEV.....Y...N.....LQR.....FWGI.FW..HKIGSVSQLEWGRY....L....S...
Q0ULA5_PHANO/246-323-CP.S.AFGD...L....RNL.....M...S.....LRK.....AWSR.......ICSA....PGIF....I....A...
A6SHP6_BOTFB/195-284-SP.A.LFGR...L....YAV.....E...S.....LGD.....FWSK.TW..HNVFSA....PCAS....L....A...
B2W4U1_PYRTR/280-366-WS.LSLFGN...I....KNA.....W...S.....VRS.....YWSR.HW..HNFIYH....SFNG....H....I...
Q11QG1_CYTH3/167-243-VK.E.LFRA...P....YKA.....T...S.....LKE.....FWGR.RW..NMAFSE....MTAV....V....V...
B7G275_PHATC/248-337-VQ.L.NFNP...L....TAS.....S...S.....PSD.....FWGR.RW..NRLVSS....GLKR....G....I...
A3ZXR5_9PLAN/169-248-AP.R.LMNA...P....LAA.....T...S.....ISD.....FWGR.RW..NIAFRD....LTHR....F....L...
A7ETV0_SCLS1/27-116-WNFA.VYGS...L....GEA.....Y...T.....IRR.....YRGI.VW..HQFLRRDLIGWASI....M....S...
A1CLH2_ASPCL/277-368-YP.P.LFAN...F....FNF.....R...T.....VLDHGLPGWWGR.RW..HQTYRY....AFAE....T....A...
A1D5T3_NEOFI/290-381-YP.P.LFNS...F....WDFKPVFDY...G.....LDG.....WWGR.RW..HQAYRY....AFSE....T....A...
A9B779_HERA2/181-260-VQ.P.LFLQ...P....IYA.....R...S.....VSE.....WWGK.RW..NLAVHT....VLSL....V....F...
A2R9E5_ASPNC/443-536-YP.P.AFGP...F....FTSI..LDH...S.....LAG.....CWSL.WW..HQLFRY....GFIS....A....A...
C4JNF5_UNCRE/338-429-YP.N.LFGP...F....LSS.....VLDKG.....LAG.....AWSK.WW..HQVFRF....AFVS....P....T...
B6HMX5_PENCW/331-421-YS.D.AFGP...FF.TPVLD.....E...G.....LAG.....CWGR.WW..HQIFRY....GFVA....S....A...
A1C9Z9_ASPCL/340-433-YS.P.AFGPFRAP....ILD.....S...G.....LAG.....CWSQ.WW..HQLFRF....GFTS....T....A...
D4ASB5_ARTBC/344-439-YP.P.YFGD...VL.IPILD.....E...G.....LVG.....FWGK.FW..HKQFRA....GFLA....P....G...
A9B206_HERA2/178-253-VA.A.LFRQ...P....LQS.....R...S.....LRD.....FWSV.RW..NIAFVE....MNKQ....L....F...
C7YGR5_NECH7/341-430-YT.S.IFGS...F....SQV.....LD.RG.....LAG.....WWGS.WW..HQTFRL....QFVA....P....A...
A6RHB9_AJECN/147-239-YP.K.AFGS...C....FSSL..LDH...G.....LIG.....FWSK.WW..HQIFRF....SFVQP.SNC....I...
C5GAL9_AJEDR/357-446-YP.K.IFGP...C....FSSL..LDH...G.....LIG.....FWSK.WW..HQVFRF...NFLQP....S....N...
Q0UFW4_PHANO/200-286-WA.P...YS...I....VLD.....K...G.....LAG.....WWGS.WW..HQTFRF....AFQE....P....S...
C5FVY5_ARTOC/341-437-YP.P.YFGD...L....LSS.....ILDRG.....LIG.....LWGT.CW..HKHFRA....GFLA....P....G...
B8MBR3_TALSN/324-425-AR.S.ITHQ...PVDTFGSA.....S...SVLDGGLVG.....AWNT.WW..HQLFRF....GFSE....C....S...
Q0HJ90_SHESM/25-98-MR.N.MLSR...A....LGA.....K...S.....FPI.....FWH..YW..NPIWGY....YLSR....N....V...

PF03062

YA71_SCHPO/187-531.PP-ENIVRC---M----CNN-----Y---S-----AVG-----FWRA--W--HRSFNR----WLIR----Y----I---
MBOA7_HUMAN/218-419...-......---T----DFC-----V---R-----VRD-----GMRY--W--NMTVQW----WLAQ----Y----I---
PORCN_HUMAN/115-402DLT-VSKPLN---V----ELP-----R---S-----MVE-----VVTS--W--NLPMSY----WLNN----Y----V---
MBOA7_CAEEL/100-411IVN-LDIPK.---V----EFS-----D---G-----FRD-----GMKA--W--NRSVQT----WLAL----Y----V---
MBOA5_MOUSE/126-437CAN-MKVWL.---F----ETT-----P---R-----FNG-----TIAS--F--NINTNA----WVAR----Y----I---
O18241_CAEEL/167-455FRP-PPPPIC---I----SRV-----S---L-----YSR-----MWRF--F--DNGLYQ----FLKY----Q----V---
O01925_CAEEL/102-410VRD-LHIIK.---W----ETG-----H---D-----YNS-----VVES--F--NCGTNT----FAKN----H----I---
ARE1_YEAST/202-609FAD-RYFYGD---W----WNC-----V---S-----FEE-----FSRI--W--NVPVHK----FLLR----H----V---
ARE2_YEAST/215-641FGD-RYFYGD---W----WNC-----V---S-----WAD-----FSRI--W--NIPVHK----FLLR----H----V---
AREH1_SCHPO/188-536...-...YGA---W----WNT-----V---T-----WDE-----FSRE--W--NKPVHV----FLMR----H----V---
Q17498_CAEEL/120-435FAD-RQFYLN---W----WHS-----S---N-----MAE-----YYRN--W--NLVVHD----WLYA----Y----V---
SOAT1_HUMAN/171-520..D-RMFYKD---W----WNS-----T---S-----YSN-----YYRT--W--NVVVHD----WLYY----Y----A---
SOAT2_HUMAN/149-494.DR-MFYRDW---W----.NS-----T---S-----FSN-----YYRT--W--NVVVHD----WLYS----Y----V---
DGAT1_HUMAN/153-474.DR-EFYRDW---W----.NS-----E---S-----VTY-----FWQN--W--NIPVHK----WCIR----H----F---
DLTB_BACSU/102-391.SP-ENFNKP---F----.IS-----K---N-----IKD-----FWNR--W--HMSLSF----WFRD----Y----V---
Q53662_STAAU/117-404.TP-PNFDKP---F----.KA-----K---N-----IKD-----FWNR--W--HMTLSF----WFRD----C----I---
Q9X2N5_STAXY/117-404.TP-QNFKQP---F----.KA-----K---N-----IKD-----FWNR--W--HMSLSF----WFRD----C----I---
Q9S390_LISMN/99-390.TP-MNFNKP---F----.AA-----R---N-----IKE-----FWNR--W--HMTLSF----WFRD----Y----V---
DLTB_LACRH/103-398.TP-MNFNKP---W----..S-----H---I-----TSR-----LLNR--W--QLSLSF----WFRD----Y----I---
Q9CG50_LACLA/100-390.LP-HNFNKP---F----.LA-----K---N-----IHD-----FWQR--W--HMTLSF----WFRD----F----V---
O68577_STRMU/108-400.SP-TNFNQP---F----.KS-----Q---D-----LKE-----FWNR--W--HMSLSF----WFRD----F----V---
Q97N83_STRPN/106-398.SP-INFNKP---F----.LS-----R---D-----LKE-----FWNR--W--HMSLSF----WFRD----F----V---
Q99ZA7_STRP1/108-400.TP-ENFNMP---F----.LS-----A---S-----LKD-----FWNR--W--HMSLSF----WFRD----Y----V---
O25526_HELPY/120-426KLP-INFNSP---Y----.KA-----L---N-----IQD-----FWRR--W--HITLSR----FLKE----Y----L---
Q9ALT7_CAMJU/111-405ALP-VNFNSP---Y----.KA-----L---N-----IAD-----FWRK--W--HITLGR----FLKD----Y----L---
ALGI_AZOVI/108-385...-ENFNQP---Y----.IS-----Q---S-----ITE-----FWRR--W--HISLST----WLRD----Y----L---
Q97IS6_CLOAB/110-386...-ENFNYP---Y----.IS-----K---S-----ITE-----FWRR--W--HISLSS----WFRD----Y----I---
O83577_TREPA/112-399.TP-ANFKRP---Y----.IS-----Q---S-----VTE-----FWRR--W--HISFSQ----WLKE----Y----L---
GUP2_YEAST/202-559.AP-ENMLRC---V----DNN-----Y---S-----TVG-----FWRA--W--HTSFNK----WVIR----Y----I---
GUP1_YEAST/170-510.TP-ENMIRC---V----DNN-----Y---S-----SLA-----FWRA--W--HRSYNK----WVVR----Y----I---
Q9C693_ARATH/108-343...-ENMPNC---I----NNC-----Y---S-----LEL-----FWKT--W--HASFNR----WLIR----Y----M---
HHAT_HUMAN/125-442LTP-PALPRC---V----STM-----F---S-----FTG-----MWRY--F--DVGLHN----FLIR----Y----V---
HHAT_DROME/127-444IPA-PNRPRC---I----GRI-----H---F-----YSD-----MWKY--F--DEGLYE----FLFQ----N----I---
NESSY_DROME/114-421CSN-VKLKL.---L----ETG-----N---T-----MEH-----YVQS--F--NVNTNQ----WVGQ----Y----I---
ALE1_SCHPO/114-426VKN-IDPIK.---F----EFA-----D---N-----IKC-----ALEA--W--NMNTNK----WLRN----Y----V---
ALE1_YEAST/111-445VRN-IDIWT.---V----ETA-----Q---N-----TRE-----MLEA--W--NMNTNK----WLKY----S----V---
Q9CAN8_ARATH/104-417AKN-VDILG.---V----ELA-----K---S-----AVQ-----IPLF--W--NIQVST----WLRH----Y----V---
Q9XUB0_CAEEL/123-366...-......---.----...-----.---.-----...-----..TN--C--NVWTDA----WLRR----I----V---
Q9VMD5_DROME/93-427TIV-NTRVLE---V----ERC-----W---T-----FRE-----GMKH--W--NVCVQY----WLAV----N----V---
Q9I935_XENLA/115-402DLT-VSRPLN---V----ELP-----R---S-----MVE-----VVTS--W--NLPMSR----WLHT----Y----V---
PORCN_DROME/126-459.QP-WRIEWP---.----...-----R---S-----ISS-----LVRS--W--NIPMHE----WLKR----Y----I---

PF13813

Q5B2E7_EMENI/234-322.NFV....TCK.VLSLP....KPSI.........LERYTNVF...LVFFLSGILHITNDVVMN-----------------
Q5B9S2_EMENI/238-325.TFI....TLR.VFCLR....RPSI.........LERYVHLG...LTFTLSGLIHAIGAFIES-----------------
Q5AR60_EMENI/251-335.DIV....ANA.LNA........QKG......TLLYKYSRLY...VGFLVSGVQHYACALLIP-----------------
Q5BD08_EMENI/258-345.TFL....AAL.AGFA.....PKST.........VAHWIRVL...VTFVESGVVHSACDMGFG-----------------
Q5BB23_EMENI/325-418.KWF....ISF.LPA........SVSS....QRIVRRIITTL...VAFGISGLIHGSGSYTQL-----------------
A8N7P7_COPC7/230-318.NYL....ADI.LHLP.....HSSP.........LRRSFKLY...LSFAISALIHYCGDYMLI-----------------
A8N7Q6_COPC7/205-291.SFV....VKD.ILGFR....PEWV.........CTHYLEIA...IAFLFSGLMHVAGEYMAN-----------------
A8N7W1_COPC7/216-300.YKI....LRL.PKK........GV.........VSRYTRLF...GAFFFSGVLHYFIDCVAM-----------------
YNV5_SCHPO/228-305.WDP....TIA.LTG........S............KFLASC...SCFFLSALFHDFAYWSIS-----------------
B0DN88_LACBS/223-307.IFV....VTK.ILH........RPRD.....KQYTPLVFLN...TVFLISGLVHVGGEYMML-----------------
B0CTS2_LACBS/198-285.IFV....VTK.ILNCP....IDKP.........YAPFVFFN...IAFFISALVHVGGDYMML-----------------
B0CP14_LACBS/223-309.TKI....MHH.LCG........HKNP....PLSNKPYTALVFLNTVFLISGLVHVGGEYMML-----------------
B8PNC8_POSPM/221-304.KAC....CRL.LGL........RQG......SWASSYTQLY...VGFAVSGLMHCGGDIMVS-----------------
B0DP95_LACBS/215-299.YKI....VRL.PRK........ST.........FTTYFKLF...VAFFISGLIHYAGDYAVL-----------------
B0DPA1_LACBS/215-299.DFV....AYK.IVGL.....PRKG........TFTTYFKLF...VAFSISGLIHYMGDYAVL-----------------
B8PN91_POSPM/156-242.KGC....CRL.LGL........QPG......SWASSYTQLY...VGFATSGFMHCVGDLVVN-----------------
B0D1K8_LACBS/215-302.YKV....LRL.PRK........ST.........FTTYFKLF...VAFFISGVIHQVGDYSAL-----------------
A1DAU4_NEOFI/241-329.NYL....ARE.LMALP....RPSL.........LERYTNIF...FVFLVSGVMHVMSDLFMG-----------------
B8NI41_ASPFN/244-334.GAF....VDV.VGIRRG..TNAS............SYTQLW...LAFTISGMMHALSQLLMP-----------------
B0D1K5_LACBS/216-304.KFI....SKN.IFHL......KSGT.......SLAWHVQLF...VAFALSGLIHLAGDYRGQ-----------------
Q0CB16_ASPTN/235-323.ELI....TAL.MPLI......SSTK.......ILARYTRLF...VAFFISALIHHASDLAMG-----------------
Q0CB78_ASPTN/235-323.NYI....TRD.LLGLP....RPSI.........IERYTNVL...IVFLLSGWIHVMTDSMQG-----------------
A5BHD5_VITVI/183-271.YFP....IRR.FTA........SRLG.....PRCSHLLAML...AAFTVSGLMHEVIYYYLT-----------------
WAXS4_ARATH/175-263.YLP....VRQ.MAG........RKMN.....SDQALFLGVF...ASFLVSGVVHELIFFYFT-----------------
B0D1K6_LACBS/216-303.KFV....VKV.LHI........KNG......TSLSWHVQLF...VVFTLSALLHLVGEYRIF-----------------
B0DRX8_LACBS/207-292.KYL....ARN.VLKFRA.GSALS............SYTQLY...VAFLLSGIIHAAGDWMAM-----------------
B6QRT0_PENMQ/256-344.HKV....LRL.PKKG.....IVQ............RYLKIV...LSFYLSGITHAVADISST-----------------
B8P281_POSPM/564-647.KGC....CRL.LRL........QPG......SWASSYTQLY...VGFATSGFMHCVGDFIVD-----------------
C5GEJ3_AJEDR/220-310.NYL....TRR.VLRLP....RPSF.........LERYLNIL...FVFSLSGILHVPFLAATS-----------------
B0D1K7_LACBS/218-306.KFVANEVLHL.QSG........TS.........LAWHVQLY...VAFALSGLLHLAGEYRAL-----------------
B0DA43_LACBS/265-345.GKP....LFL.LFG........R............A.GGVL...GAFLVSGILHDFGTWGMG-----------------
D1LC97_9HYPO/252-340.NFI....CRD.LLRLP....RPSL.........VERYMNVA...GVFLTSAVIHMAIDAHCW-----------------
Q96W92_GIBZA/251-341.NFI....CRD.FLRLP....RPSI.........VERYLNLS...LVFLGSALVHIPVDWFSL-----------------
B6HN05_PENCW/246-334.ELI....TRL.TPIF.....SESK........MVSRYMRLS...VAFLISGLIHHSSDLAMG-----------------
Q2US74_ASPOR/254-342.DFI....SFS.VLRI.....SPKS........RWACYLRVL...FAFTVSGFIHMGMDLAFG-----------------
Q2UE90_ASPOR/249-338.NFV....LRN.VFK.......IQARR.....GFIPKYARVI...IIFAISAVMHFLIDISGG-----------------
C5P066_COCP7/258-347.YKV....LRI.PKR........NG........ILARYVRVG...FVFALSGILHVVTDHTMG-----------------
C5PCP4_COCP7/167-251.QRV....LHL.QLT........SG.........VAKTVEAF...GIFFLSGLAHALASWRTG-----------------
B0Y9M2_ASPFC/246-333LYDF....LRL.PHGI......VA............RSLRLI...MAFATSGLVHFFTDQGFG-----------------
C4JIX8_UNCRE/259-348.YKV....LHI.PKP........NK........ILARYARVM...TVFVVSGLLHIMTDNALG-----------------
C7ZCA2_NECH7/246-334.NYI....CRD.LLGLP....RPSF.........IERYLNIL...IVFLASGAMHLTIDLFSY-----------------
B6H3A9_PENCW/233-321.GFI....TKD.LLGLR....PKSL.........VQRYMNVF...VVFFCSGGLHLVLDIVQG-----------------
A2QRU6_ASPNC/230-318.TAI....TCR.ILGLP....KPSL.........IERYLNLT...IVFILSGLMHVFTNVASG-----------------
A8NTB7_COPC7/251-331.SKP....LHY.FLG........K............P.GIVL...GAFLVSGVLHVFGLWGMG-----------------
ASAT1_ARATH/180-267.YEP....SLQ.LFSVLG..PNYS............QILAAF...GTFVVSGIMHELIFFYMG-----------------
A1C4D4_ASPCL/251-338.DFV....LSR.ILRLP....AGTL..........ARSLRLI...LAFAVSGLVHFFMDLGFG-----------------
B6HRC6_PENCW/265-351.RLV....TRL.LGF........KPA......SSFEKCFIAF...WTFFLSAIYHFVADWMAG-----------------
C5FXZ8_ARTOC/242-330.SFI....IQR.VLGISR.GTQLS............RYARLV...TIFAISALMHVLVDVAAG-----------------
Q0CDC3_ASPTN/224-312.HDV....LRL.PRG........TS.........KARYVKNV...IGFLVSGLMHIALDMATD-----------------
WAXS5_ARATH/175-263.YAP....MRR.VSE........RKMS.....SGWALFPGIL...AAFIVSGLVHELLFFYLI-----------------
C6TIL0_SOYBN/192-280.YKP....VRS.LLM........SKTVL...GPQWASVSGVM...ATFLVSGLMHELIFYYVT-----------------
A1D2V2_NEOFI/225-313.RMI....TRR.VARLQ....PGSQ.........HEKISIAF...WAFFVSGIFHVVADWASG-----------------
A1DC18_NEOFI/245-333.SYV....ARD.VLRLP....RPSL.........LERYTNIF...FTFFTSGVLHLACDAILG-----------------
B6HKP3_PENCW/224-312.NFI....ARD.ILGL.....PRSS........FVERYTNVF...IVFFFSGVIHVVLDSLRN-----------------
Q0CS68_ASPTN/137-225.SFL....CRD.VLRLP....RPSL.........AERYLKIT...LVFAISSCLHLAIDGRAG-----------------
B6HN85_PENCW/288-374.RQL....MGV.QSG........SS.........LDKTITAL...VIFTISGLSHALVGWALG-----------------
D4DFW4_TRIVH/660-754.GAFV.DVVGI.RRGT.....NAS............SYTQLW...LAFTISGVMHALSQLLMP-----------------
D4DK35_TRIVH/255-353.YFI....THS.ILRLP...LADSVAPESKILLLLIRYVRIQ...MAFLVSGLLHFPIDTMQG-----------------
A1DEF4_NEOFI/254-338.EVV....ARA.LGA........EKG......TLMYRYTKLY...VGFLVSGVQHYACPLLIP-----------------
B0CVR7_LACBS/274-353.GYP....GQW.IAG........Q.............YGMVF...GAFIASGLFHECAMYSMK-----------------
B8NF28_ASPFN/25-113.TQV....TRR.LIGMT...PGCRS..........EKIFVAF...WTFLLSGLCHVIADWQAG-----------------
B6H8B2_PENCW/235-322.ESI....SLR.IIG.......CSPR......SFAHKSIIAL...VAFGLSGAAHALIDWQRR-----------------
B8M887_TALSN/166-252.SFLVMDVLRV.PKG........QK........LLVKISSLF...FAFLISGLIHLHGDVISG-----------------
Q6Q889_LEPMC/242-327.LFV....ARD.LMQLR....KGSF.........QSKYVQLF...VGFGVSAGLHAGVALLCS-----------------
Q0CRW1_ASPTN/238-326.TFL....VRK.LLR.......ISKP......GPVYRYIHVL...CVFSLSGILHLINDVLQG-----------------
Q5KNT5_CRYNJ/307-391.TLI....LRA.LDLP......VS............SPFIVF...LSFFFSGAMHALGQYLMD-----------------
Q0C7G9_ASPTN/642-728.LLL....VPGGISG........TV..........KRLLVLL...VSFAVSGCVHAAGAYAVS-----------------
C9SDD4_VERA1/226-317.RTI....ARS.GLGIE....VGSK.........SEKIFVAF...WVFAVSGATHIAVNWVTK-----------------
B9HCG3_POPTR/129-219.YEP....TQN.VLV.......GNFVG.....VGKARILAMI...TTLVISGIMHELMFYYIS-----------------
B6QWC0_PENMQ/779-867.CLF....CRN.ILQLK....PGSV.........WDKTMFVL...VIYLISGIVHSFVSWNYG-----------------
D4AQU2_ARTBC/243-333.YDP....LRR.HLP........AKYGV...PESFAKGVGII...ASFSLMGLFHAYSLAPVL-----------------
C5FGQ3_ARTOC/253-336.PPE....SKA.LIL.......II............RYVRIQ...MAFLVSGLMHLPIDRMQN-----------------
C5XF80_SORBI/188-267.YEP....VRA.RWG........R............D.AGVL...AAFLMSGLLHELLYWYLT-----------------
Q0UA02_PHANO/249-339.QIV....TRK.WLRMR....RGRT.........STRLVENT...MVFAMSGLMHSAVRFVQD-----------------
C5JC80_AJEDS/224-314.YGP....IRY.TLP........ERYGV...PVSIARALGVL...ASFALMGFFHVYALKPLL-----------------
B6HGV9_PENCW/239-312...L....TRS.STL........E............RYTNLS...IVFLISAIFHVIVDILQS-----------------
C5P323_COCP7/246-336.YGP....LRR.ILP.......LRYGM....PVAFARGIGII...ASFILMGFFHVYALAPLL-----------------
D4DL18_TRIVH/237-325.RRV....LEL.KPG........SP.........REKVFLAF...FIFMASAIIHALVSWSVK-----------------
Q0ULA5_PHANO/246-323.RDV....LRL.RRG........SF.........ASKYFQLF...IGFGISAIVHGCASMFVH-----------------
A6SHP6_BOTFB/195-284.YDP....IRQ.NLP........KLGV....SIPIARSMGIL...AAFFLMAAFHVYALAPMV-----------------
B2W4U1_PYRTR/280-366.KCV....TRG.WLAM......KRGT.......LSTRLTENT...AVFFLSGLMHTAVRWQMA-----------------
Q11QG1_CYTH3/167-243.YKP....LKN.VYG........I............T.AAMI...ASFLISGLLHEIAISFPV-----------------
B7G275_PHATC/248-337.FRP....FRK.NGY........G............RNTAAL...ATFLVSGLLHEYILVIIA-----------------
A3ZXR5_9PLAN/169-248.FRP....LAA.RFS........P............Q.WAVM...LGFAFSGVVHDFVISYPA-----------------
A7ETV0_SCLS1/27-116.SNI....FRI.PQT........SK.........YNKFAMLY...LVFFISACMHAMIYLPAK-----------------
A1CLH2_ASPCL/277-368.RHC....VPV.QSS........QE.........RDRFLRQC...VAFLLSGIMHTCAVHAHF-----------------
A1D5T3_NEOFI/290-381.RYV....VPN.FEN........KD.........MTRFLRHS...VAFLLSGLVHFCAVHSHF-----------------
A9B779_HERA2/181-260.WQP....LKP.IIG........W............R.WAAA...VVFIASGLLHELLLSYPA-----------------
A2R9E5_ASPNC/443-536.HWL....LSL.LPS........RLST....SRSVRRVLTAF...VAFSLSGLVHASGSYVQN-----------------
C4JNF5_UNCRE/338-429.AWV....FPY.LPHF.....LRKK........PYFPLLRAI...VAFALSGLIHACGSYTQL-----------------
B6HMX5_PENCW/331-421.RWI....LSV.LPAGLASHLQVR............RVTYVM...VAFCLSGFVHACGSHTQI-----------------
A1C9Z9_ASPCL/340-433.HWL....LAL.LPRPL....AAQT........TTRRVAMTL...VAFSLSGLIHACGSYTQF-----------------
D4ASB5_ARTBC/344-439.NWI....KSK.LMS........RNPGRK.WPQSIFWGLQVV...ISFTLSGILHFSGSYTQN-----------------
A9B206_HERA2/178-253.LRR....LGR.YG......................PSTLVI...GIFLLSGIFHELGLSYPA-----------------
C7YGR5_NECH7/341-430.KYL....VDR.GYL........SKK......TVLTQVITMY...VSFFQSGLLHAAGSISCM-----------------
A6RHB9_AJECN/147-239.YDH....LPH.RLQKP....FLR............RLLQLY...VVFGLSGLLHAAGSYTQL-----------------
C5GAL9_AJEDR/357-446.WIY....AHL.PQRLQK..PFVR............QSLQLY...IAFGLSGLLHAAGSYTQL-----------------
Q0UFW4_PHANO/200-286.RKA....IEV.LGM.......DRKS.......ALAKAGQLL...TAFAMSGLVHASGSYTSP-----------------
C5FVY5_ARTOC/341-437.NWVKSVVFLK.LNG........GIQW....PPLIFWGLQVF...ISFTLSGIVHFAGSYTQM-----------------
B8MBR3_TALSN/324-425.RFI....TEL.VFPI......GSQKNG...YKLARRILQII...LAFSLSGLVHAMGSYTTF-----------------
Q0HJ90_SHESM/25-98.MRP....TSQ.FLP........M.............WLAVL...VTFLVSGALHDLAVALVK-----------------

PF03062

YA71_SCHPO/187-531-YVP--------LGG.......S..-------..NHSILNLF---IIFTFVALWHDISWELFAWGWLIVLFILPERLCCF
MBOA7_HUMAN/218-419-YKS--------A............-------PARSYVLRSA---WTMLLSAYWHGLHPGYYLSFLTIPLCLAAEGRLES
PORCN_HUMAN/115-402-FKN--------A............-------LRLGTFSAVL---VTYAASALLHGFSFH..LAAVLLSLAFITYVEHVL
MBOA7_CAEEL/100-411-HSR--------V............-------....KVMRVE---TTMLVSAVWHGTYAGYFMSFGVVAMCAILEDVIFK
MBOA5_MOUSE/126-437-FKR--------L...........K-------FLGNKELSQG---LSLLFLALWHGLHSGYLICFQMEFLIVIVEKQVSS
O18241_CAEEL/167-455-YIP--------A..MRK.PLPLFW-------SILRSLGALC---AVFGVVLAWHGTRRHFIFWVTLSATELIVERIGWQ
O01925_CAEEL/102-410-HRR--------L.R......WV..-------..NNKLASHV---ITLSYLAIWHGYHLGYFLLFGVELGCVQAQNQLYA
ARE1_YEAST/202-609-YHS--------SMG.........A-------LHLSKSQATL---FTFFLSAVFHEMAM.FAIFRRVRGYLFMFQLSQFV
ARE2_YEAST/215-641-YHS--------S.........MSS-------FKLNKSQATL---MTFFLSSVVHELAM.YVIFKKLRFYLFFFQMLQMP
AREH1_SCHPO/188-536-YHS--------S.........ISG-------FKLKKSHAVL---LTFLISALVHEFVM.LLATGKFRCYILTFQLLQIP
Q17498_CAEEL/120-435-FRD--------LAA.......YNP-------GRKGQRAAQM---AVFFLSAVFHEYWFG.VAFRCFYPVMFVLYFIFGG
SOAT1_HUMAN/171-520-YKD--------F........LWFF-------SKRFKSAAML---AVFAVSAVVHEYALAVCLSFFYPVLFVL...FMFF
SOAT2_HUMAN/149-494-YQD--------..G......LRLL-------GARARGVAML---GVFLVSAVAHEYIFCFVL.GFFYPVMLILFLVIGG
DGAT1_HUMAN/153-474-YKP--------ML..........R-------RGSSKWMART---GVFLASAFFH....EYLVSVPLRMFRLWAFTGMMA
DLTB_BACSU/102-391-FMR--------FVFWMTKKKWIKN-------RMAVSNIGYF---LLFMLMGVWHGLAPQYIIYGLYHAVLMTCYNFFEK
Q53662_STAAU/117-404-YMR--------SLFYMSRKKLLKS-------QFAMSNVAFL---INFFIMGIWHGIEVYYIVYGLYHAALFIGYGYYER
Q9X2N5_STAXY/117-404-YMR--------ALFFMSKKRLLKN-------QFTMSNIAFS---LNFLIMGIWHGIEVHYILYGLYHAVLFIGYGYYEK
Q9S390_LISMN/99-390-FMR--------FVFWVTKKKWFKS-------KFTIAYLAYF---VNFFIMGVWHGLHWYYIVYGLYQATLIVGFDLFER
DLTB_LACRH/103-398-YMR--------FVFFMMKHKWIKS-------RVWTAFVGYL---VLFLIMGIWHGETWYYIVYGLFHAMLINLTDAWLR
Q9CG50_LACLA/100-390-FMR--------LVKTFMVKKWSKN-------MITISNVGYL---ANMLLMGFWHGLTWYYILYGFYHAMLMIGYDAWKR
O68577_STRMU/108-400-FMR--------LVKVLVKNKVFKN-------RNVTSSVAYI---VNMLIMGFWHGVTWYYITYGLFHGVGLVLNDAWLR
Q97N83_STRPN/106-398-FMR--------MVMVLTRKKVFKN-------RNVTSSMAYI---VNMLIMGFWHGVTWYYIAYGLFHGLGLVINDAWVR
Q99ZA7_STRP1/108-400-FMR--------LVHLLIKHKTFKN-------RNVTSGVAYL---VNMLVMGFWHGLTWYYIAYGLFHGIGLIINDAWIR
O25526_HELPY/120-426-YIP--------LGGN.....RVKE-------LIV..YRNLI---LVFLIGGFWHGAGWTFIIWGLLHGIALSVHRAYSH
Q9ALT7_CAMJU/111-405-YIP--------LGGN....RFGKF-------IN...LRNLF---IVAFLSGVWHGAGWGFVIWGILHAIAMISHRIYSF
ALGI_AZOVI/108-385-YIS--------LGG.......NRG-------TTFQTYRNLI---LTMLLGGLWHGANWTFIIWGAWHGTWLAIERALRI
Q97IS6_CLOAB/110-386-YIP--------LGGS.....RVDN-------KDK.LIRNLF---IVWVSTGVWHGAEWTFIMWGFLNFVFIALEKVFSF
O83577_TREPA/112-399-YFS--------LGG.......SRF-------GIKRTVCALF---FTMLIAGLWHGVRLTFLLWGMAQGVALVIERVYRE
GUP2_YEAST/202-559-YVP--------FGG.......S..-------..NNKILTSF---AVFSFVAIWHDIQLRVLFWGWLTVLLLLGETYITN
GUP1_YEAST/170-510-YIP--------LGG.......S..-------..KNRVLTSL---AVFSFVAIWHDIELKLLLWGWLIVLFLLPEIFATQ
Q9C693_ARATH/108-343-YIP--------LGG.......S..-------..RRKFLNVW---VVFTFVAMWHDLEWKLLSWAWLTCLFFMPEMLLKS
HHAT_HUMAN/125-442-YIP--------VGG.......SQH-------GLLGTLFSTA---MTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRR
HHAT_DROME/127-444-YAE--------LCG.......KRS-------SAAAKFGATA---LTFAFVFVWHGCYTYVLIWSILNFLCLAAEKVFKT
NESSY_DROME/114-421-YKR--------L...........K-------FLNNRTISYG---AALGFLAVWHGYHSGYYMTFLMEYMVVSTEKQITR
ALE1_SCHPO/114-426-YLR--------VA.........KK-------GKRPGFKSTL---STFTVSAMWHGVSAGYYLTFVSAAFIQTVAKYTRR
ALE1_YEAST/111-445-YLR--------VT.........KK-------GKKPGFRSTL---FTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYRR
Q9CAN8_ARATH/104-417-YER--------IV.........KP-------GKKAGFFQLL---ATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIYR
Q9XUB0_CAEEL/123-366-YER--------V............-------...EDPYRVI---AVYVTGVAWHGLAVEYYLSFLTSAIFTLLAKVGST
Q9VMD5_DROME/93-427-YKL--------F............-------..PSKKYRTG---ATLLCSAYWHGFRPGHYFCIMGAPFYVSLEDMWDK
Q9I935_XENLA/115-402-FKN--------A............-------LKLGKFHAII---VTYAASALLHGMSFH..LAAVLLSLGFITYVEHVL
PORCN_DROME/126-459-YAP--------CKP......TAST-------SRGRILVVVL---STYLVSSLLHGMDLRIYL..VLISLAFLAEGESLL

PF13813

Q5B2E7_EMENI/234-322-------VPI........RDSG.....AMT....FFLS
Q5B9S2_EMENI/238-325-------DN.........QEAL.....STL....FFFA
Q5AR60_EMENI/251-335-------S...........AEY.....GWG....MFWQ
Q5BD08_EMENI/258-345-------IPF........GESG.....GVV....FFSL
Q5BB23_EMENI/325-418-------GENT......RPVTG.....TFL....FFIL
A8N7P7_COPC7/230-318-------QSW.......HGATG.....ALI....FFFS
A8N7Q6_COPC7/205-291-------RG..........RTV.....SYG....ALIF
A8N7W1_COPC7/216-300-------G............HR.....GSL....AIRT
YNV5_SCHPO/228-305-------G............RC.....SPA....FFFQ
B0DN88_LACBS/223-307-------G............RL.....GLG....AFRF
B0CTS2_LACBS/198-285-------G............KP.....GTGP.FWFFIL
B0CP14_LACBS/223-309-------G............RLG...SSLG....AFRF
B8PNC8_POSPM/221-304-------R............KL.....FGA....SFPF
B0DP95_LACBS/215-299-------G............HW.....SGG....GLVC
B0DPA1_LACBS/215-299-------G............HW.....SGG....GLIC
B8PN91_POSPM/156-242-------PM.........LFGT.....SFP....FFIA
B0D1K8_LACBS/215-302-------GH.........WYGC.....ALA....FFIY
A1DAU4_NEOFI/241-329-------ISM........SHST.....SLL....FFCS
B8NI41_ASPFN/244-334-------RPGN.....VTTSEI.....AVG....IFLF
B0D1K5_LACBS/216-304-------D............DWTK.GGTMR....FFLL
Q0CB16_ASPTN/235-323-------IPA........SEAG.....ALR....FFVL
Q0CB78_ASPTN/235-323-------VPP........SDSG.....AMV....FFPL
A5BHD5_VITVI/183-271-------RV.........TPTW....EVTW....FFVL
WAXS4_ARATH/175-263-------R............ESPT.GEVTL....FFVL
B0D1K6_LACBS/216-303-------N............NWTS.GGAMS....FFVI
B0DRX8_LACBS/207-292-------R............SI....TSAR....LTIQ
B6QRT0_PENMQ/256-344-------LSW........GEQL.....TVE....FFLI
B8P281_POSPM/564-647-------R............AL.....FGM....SFPF
C5GEJ3_AJEDR/220-310-------ISIL......DSWRG.....SML....YFTS
B0D1K7_LACBS/218-306-------N............NWKT.GGAMR....FFVL
B0DA43_LACBS/265-345-------NGS........DFRC.....IAG....FFII
D1LC97_9HYPO/252-340-------GP.........PSKL....PALA....FFGS
Q96W92_GIBZA/251-341-------PPPS......KPPVL.....ALA....FFGS
B6HN05_PENCW/246-334-------IPR........AEAG.....SLR....FFLL
Q2US74_ASPOR/254-342-------VP..........RATT...GAVW....FFCL
Q2UE90_ASPOR/249-338-------IPV........HKSG.....AVH....FFCT
C5P066_COCP7/258-347-------IP..........VRES...GAMD....FFLT
C5PCP4_COCP7/167-251-------E............GF.....AHL....DILF
B0Y9M2_ASPFC/246-333-------LSL........NQSG.....ALW....FFCL
C4JIX8_UNCRE/259-348-------IP..........FRES...GALS....FFAT
C7ZCA2_NECH7/246-334-------KPP........SKAP.....TLA....FFGS
B6H3A9_PENCW/233-321-------IPP........QESG.....AML....FFVT
A2QRU6_ASPNC/230-318-------IEG........GNTG.....AML....FFIA
A8NTB7_COPC7/251-331-------RGT........EFWT.....VAG....YFLL
ASAT1_ARATH/180-267-------RL.........RPDW....KMMW....FFLI
A1C4D4_ASPCL/251-338-------VSL........DQSG.....GLW....FFCL
B6HRC6_PENCW/265-351-------E............PC.....RPMN.DLFFFL
C5FXZ8_ARTOC/242-330-------MPV........SSSG.....AIR....FFLT
Q0CDC3_ASPTN/224-312-------ISV........YQSG.....GLA....FFCG
WAXS5_ARATH/175-263-------R............EMPT.GEVTL....FFVL
C6TIL0_SOYBN/192-280-------RV.........SPTW....EVTC....FFLL
A1D2V2_NEOFI/225-313-------E............PCYL.IDDMF....FFVA
A1DC18_NEOFI/245-333-------VPP........SVSG.....AMP....FFCL
B6HKP3_PENCW/224-312-------VSP........WEFG.....TMA....FFLS
Q0CS68_ASPTN/137-225-------IML........PRSG.....ALR....CFLL
B6HN85_PENCW/288-374-------D............AAL...SRDV....LFFQ
D4DFW4_TRIVH/660-754-------RPAN.....ITPGEI.....VIG....IFLF
D4DK35_TRIVH/255-353-------VPL........RESA.....IVT....FFTV
A1DEF4_NEOFI/254-338-------S...........LHY.....GWG....MFWQ
B0CVR7_LACBS/274-353-------RG.........FDHS.....ATV....FFAL
B8NF28_ASPFN/25-113-------E............PCHP.HDDLL....FFVA
B6H8B2_PENCW/235-322-------SP.........DWHL.....NIY....WFLL
B8M887_TALSN/166-252-------I...........PYT.....ESG....AVIS
Q6Q889_LEPMC/242-327-------K............AL....NDDS....ALFF
Q0CRW1_ASPTN/238-326-------VP..........WRES...GALL....FFCS
Q5KNT5_CRYNJ/307-391-------PV..........PALL...PIFA....LFPL
Q0C7G9_ASPTN/642-728-------GDA........YGAG.....VMV....VFFI
C9SDD4_VERA1/226-317-------ATA.......PVEDLM...GDMV....FLML
B9HCG3_POPTR/129-219-------CGT........RPTW....EVTW....FFVL
B6QWC0_PENMQ/779-867-------D............KCGW.SSDIW....WFCC
D4AQU2_ARTBC/243-333-------PLD........GILR.....IIA....FFLL
C5FGQ3_ARTOC/253-336-------IPY........RESG.....VAM....FFTV
C5XF80_SORBI/188-267-------LQ.........QPRG.....EML....LFFM
Q0UA02_PHANO/249-339-------PG.........ASDCM...VITL....WYIG
C5JC80_AJEDS/224-314-------PVD........ALAR.....IYT....FFLL
B6HGV9_PENCW/239-312-------IPV........ERSG.....SMP....FYLA
C5P323_COCP7/246-336-------PLD........ALLR.....ISA....FFLL
D4DL18_TRIVH/237-325-------D............KS....ESVAR.IYNFSL
Q0ULA5_PHANO/246-323-------R............SL....EDDG....AFAC
A6SHP6_BOTFB/195-284-------T...........EKAL..FRIGM....FFVL
B2W4U1_PYRTR/280-366-------P............WA....DIWA....ITFW
Q11QG1_CYTH3/167-243-------K............TG.....YGL....PFLY
B7G275_PHATC/248-337-------IRKVIQMNQISLRGT.....HFL....FFFW
A3ZXR5_9PLAN/169-248-------GG.........GYGW.....PTA....YFLL
A7ETV0_SCLS1/27-116-------I............RISG.CGISH....IFQW
A1CLH2_ASPCL/277-368-------AP.........RARVG..GGSLL....FFAV
A1D5T3_NEOFI/290-381-------VA.........PDSVY..FGALL....FFML
A9B779_HERA2/181-260-------AG.........GWGW.....PLG....YFVV
A2R9E5_ASPNC/443-536-------R............ETYPFAGPFR....FFVL
C4JNF5_UNCRE/338-429-------G............TT.....RPWGPFSFFVV
B6HMX5_PENCW/331-421-------E............DT.....SPIS..GPFLF
A1C9Z9_ASPCL/340-433-------A............HTTPLTGPFL....FFLL
D4ASB5_ARTBC/344-439-------S............STNP.FNQFL....FFAL
A9B206_HERA2/178-253-------Q............AG.....WGQ....AMAY
C7YGR5_NECH7/341-430-------R............DTKI.WRSPC....FFLL
A6RHB9_AJECN/147-239-------AP..........TRPF..SGIFL....FFFL
C5GAL9_AJEDR/357-446-------AP..........TKP.....FPN....LFLF
Q0UFW4_PHANO/200-286-------G............ETYPWANPFL....FFML
C5FVY5_ARTOC/341-437-------APT........NPSR.....QFL....FFAL
B8MBR3_TALSN/324-425-------S............NSRP.WNAFL....FFVL
Q0HJ90_SHESM/25-98-------..............W.....QTM....FFFT

PF03062

YA71_SCHPO/187-531MSRRTGLTKHPYYRYISGFGAALNIYFMIICNLIGFAV
MBOA7_HUMAN/218-419ALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSL
PORCN_HUMAN/115-402RKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLF
MBOA7_CAEEL/100-411LV..PVDTETGVRPKWFRILYTHTIRCRGFEMLATGFL
MBOA5_MOUSE/126-437LIRDSPALSSLASITALQPFYYLVQQTIHWLFMGYSMT
O18241_CAEEL/167-455IW.KIPKVQRIRKRLGEHCCRRIMATLMLLTVTPGIFG
O01925_CAEEL/102-410LIK....RTPGWSEAISKPISRPFIWIFGKLTISYSMG
ARE1_YEAST/202-609WTALSNTKFLRARPQLSNVVFSFGVCSGPSIIMTLYLT
ARE2_YEAST/215-641LVALTNTKFMRNRTIIGNVIFWLGICMGPSVMCTLYLT
AREH1_SCHPO/188-536LYDLQQMFAFKKRDILGNVFFWIGMFTGPSFLCILYIV
Q17498_CAEEL/120-435TF..FAVSRLITNRSAWNTALWFNLLIGTGMFIAFYGQ
SOAT1_HUMAN/171-520GMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQ
SOAT2_HUMAN/149-494MLN..FMMHDQRTGPAWNVLMWTMLFLGQGIQVSLYCQ
DGAT1_HUMAN/153-474QIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVH
DLTB_BACSU/102-391WNKKYKWLPSNRWTTILAIVITFHFVCFGFYIFSGKPF
Q53662_STAAU/117-404WRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI
Q9X2N5_STAXY/117-404WRKNHPPRWSNQYTTMLSIIVTFHFVTFGFLIFSGKLF
Q9S390_LISMN/99-390FNKKHKFYPKNKITYVIGVIITFQFVCFGFLIFSGILD
DLTB_LACRH/103-398FKKKHKDFFPHNRATHYPSPFSMTANAVCFSFLIFSGF
Q9CG50_LACLA/100-390LKKRKNWKIPDNKWTSAISIFITFNLVFISFLIFSGIP
O68577_STRMU/108-400KKKRLNKERKAKNLSPLPENGWTRALGIVITFNVVMLS
Q97N83_STRPN/106-398KKKTLNKERKKAGKAALPENRWIQLLGMVVTFHVVMLS
Q99ZA7_STRP1/108-400KKKEINRHRKKKGLSPLFQSRAFHVLCIVVTFHVVMFS
O25526_HELPY/120-426ATRKFHFTMPKILAWLITFNFINLAWVFFRAKNLESAL
Q9ALT7_CAMJU/111-405WAKGKTFLNSKIYKIISWFITFNFINIAWIFFRSENLQ
ALGI_AZOVI/108-385DAAPKTIRPLRWVFAFLLVMVGWVIFRAENLDVAWRMY
Q97IS6_CLOAB/110-386DDLKINPVIKHIYALFI.INLGWVLFRSENLIQAGKYV
O83577_TREPA/112-399KRRVNGANAFGSSSVMGRWKARAMRCIRVSALFLFVSV
GUP2_YEAST/202-559CFSRYRFRSWYRFVCGIGAAINICMMMIINVYGFCLGA
GUP1_YEAST/170-510IFSHYTDAVWYRHVCAVGAVFNIWVMMIANLFGFCLGS
Q9C693_ARATH/108-343ASSAYKVESAFGEFLLRELKALSGAVTITCLMIANLAG
HHAT_HUMAN/125-442LVETPCIQDSLARYFSPQARRRFHAALASCSTSMLILS
HHAT_DROME/127-444FTAMPEYQRWTQRHLGAVGAQRLYAMLATQLFIPAAFS
NESSY_DROME/114-421FYTKVVLPQWGHILNNSDIYKLLYFITLKSYNVVYMGW
ALE1_SCHPO/114-426HVRPFFLKPDMETPGPFKRVYDVIGMVATNLSLSYLII
ALE1_YEAST/111-445NFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQ
Q9CAN8_ARATH/104-417WQQAIPPK.....MAMLRNVLVLINFLYTVVVLNYSSV
Q9XUB0_CAEEL/123-366LFQAIKMAANTVFPLLVLHANLIFLILKFNVPKRWRIC
Q9VMD5_DROME/93-427LVRKSATGTSRRVIDVIFWIFKWFAFSYLGEAFLLSSF
Q9I935_XENLA/115-402RRRLAEIFSACILSKKCPSGCTHRNKKGPLVYFLNLMF
PORCN_DROME/126-459RRQLASLLNACITANLCPGKERCRYSHCPSKRRLNSLS

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window