Sequence alignment for CL0520

PF01500

KRA11_HUMAN/1-177M..ACCQTSFCGFPSCSTSGTCG..............................................SSCCQPSCCET
KRA3A_SHEEP/1-130T.GSCCG......PTFSSLS.CGGGCLQPCCYRD...................................PCCCRPVSSTQ
Q28707_RABIT/1-126MVNSCCG......SVCSERG.CGQDFCQE........................................ESCCRPSCCRP
KRB2C_SHEEP/1-152M..ACCSTSFCGFPICSTAGTCG..............................................SSCCRSTCSQT
KRA13_HUMAN/1-177M..TCCQTSFCGYPSCSTSGTCGSSCCQPSCCETSCCQPSCCETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPSCCET
O70148_RAT/1-188M..ACCATSFCGFPTCSTGGTCGSNCCQPSCSQSSCCQPSCSQ..........................SSCCQPSCTQS
KRB2A_SHEEP/1-172M..ACCSTSFCGFPICSTGGTCGSSPCQPTCCQ....................................TSCCQPTSIQT
KRB2D_SHEEP/1-182M..ACCSTSFCGFPTCSTGGTCGSNFCQPTCCQ....................................TSCCQPTSIQT

PF13885

KRA45_HUMAN/25-69--------------------------------------------------------------------------------
KRA45_HUMAN/105-150--------------------------------------------------------------------------------
A6NC61_HUMAN/114-158--------------------------------------------------------------------------------
D3YXB6_MOUSE/83-125--------------------------------------------------------------------------------
KRA46_HUMAN/130-174--------------------------------------------------------------------------------
A0JN45_BOVIN/96-140--------------------------------------------------------------------------------
A0JN45_BOVIN/141-186--------------------------------------------------------------------------------
A2A4L9_MOUSE/69-113--------------------------------------------------------------------------------
A2A4M0_MOUSE/24-68--------------------------------------------------------------------------------
A2A4M2_MOUSE/84-127--------------------------------------------------------------------------------
A2A5X3_MOUSE/75-120--------------------------------------------------------------------------------
A2A5X3_MOUSE/232-274--------------------------------------------------------------------------------
KR10D_MOUSE/88-132--------------------------------------------------------------------------------
A4IF42_MOUSE/141-185--------------------------------------------------------------------------------
A6NFW2_HUMAN/170-213--------------------------------------------------------------------------------
KR108_BOVIN/111-155--------------------------------------------------------------------------------
A6QQG8_BOVIN/23-64--------------------------------------------------------------------------------
A6QQG8_BOVIN/120-162--------------------------------------------------------------------------------
A8MPS1_HUMAN/106-150--------------------------------------------------------------------------------
KR10D_HUMAN/68-112--------------------------------------------------------------------------------
KR10D_HUMAN/128-172--------------------------------------------------------------------------------
KR10D_HUMAN/193-237--------------------------------------------------------------------------------
KRA96_HUMAN/80-124--------------------------------------------------------------------------------
KR291_HUMAN/115-159--------------------------------------------------------------------------------
KR291_HUMAN/165-209--------------------------------------------------------------------------------
KRA91_HUMAN/37-79--------------------------------------------------------------------------------
KRA91_HUMAN/80-122--------------------------------------------------------------------------------
A8QW00_BOVIN/128-172--------------------------------------------------------------------------------
B1AQ90_MOUSE/24-68--------------------------------------------------------------------------------
B1AQ90_MOUSE/79-123--------------------------------------------------------------------------------
B1AQA8_MOUSE/109-152--------------------------------------------------------------------------------
B1AQA9_MOUSE/24-68--------------------------------------------------------------------------------
B1AQA9_MOUSE/178-222--------------------------------------------------------------------------------
B6CQV3_CAPHI/24-66--------------------------------------------------------------------------------
B9EIL2_HUMAN/41-85--------------------------------------------------------------------------------
D2HB39_AILME/26-71--------------------------------------------------------------------------------
D2HIQ1_AILME/153-197--------------------------------------------------------------------------------
D2HIQ2_AILME/193-237--------------------------------------------------------------------------------
D2HIQ2_AILME/253-297--------------------------------------------------------------------------------
D2HJK5_AILME/29-73--------------------------------------------------------------------------------
D2HR47_AILME/5-49--------------------------------------------------------------------------------
D2HR48_AILME/30-74--------------------------------------------------------------------------------
D3YXB3_MOUSE/75-119--------------------------------------------------------------------------------
D3Z5T3_MOUSE/78-123--------------------------------------------------------------------------------
D3ZD90_RAT/24-64--------------------------------------------------------------------------------
D3ZD90_RAT/103-146--------------------------------------------------------------------------------
D3ZDA4_RAT/130-174--------------------------------------------------------------------------------
D3ZDD4_RAT/137-184--------------------------------------------------------------------------------
D3ZDT9_RAT/84-128--------------------------------------------------------------------------------
D3ZDU4_RAT/27-71--------------------------------------------------------------------------------
D3ZEA5_RAT/163-207--------------------------------------------------------------------------------
D3ZGU7_RAT/27-65--------------------------------------------------------------------------------
D3ZJ72_RAT/72-115--------------------------------------------------------------------------------
D3ZKB5_RAT/71-114--------------------------------------------------------------------------------
D3ZMN9_RAT/29-73--------------------------------------------------------------------------------
D3ZMN9_RAT/133-177--------------------------------------------------------------------------------
D3ZMV5_RAT/79-121--------------------------------------------------------------------------------
D3ZNL6_RAT/173-218--------------------------------------------------------------------------------
D3ZNY7_RAT/180-226--------------------------------------------------------------------------------
D3ZRR1_RAT/101-148--------------------------------------------------------------------------------
D3ZTU8_RAT/141-185--------------------------------------------------------------------------------
D3ZUG4_RAT/130-173--------------------------------------------------------------------------------
D3ZV25_RAT/47-91--------------------------------------------------------------------------------
D3ZV25_RAT/107-151--------------------------------------------------------------------------------
D4A2F4_RAT/27-71--------------------------------------------------------------------------------
D4A2F4_RAT/73-117--------------------------------------------------------------------------------
D4A3Q1_RAT/42-85--------------------------------------------------------------------------------
D4A5R4_RAT/44-88--------------------------------------------------------------------------------
D4A8A6_RAT/73-116--------------------------------------------------------------------------------
D4A8P6_RAT/91-136--------------------------------------------------------------------------------
D4A8T7_RAT/139-184--------------------------------------------------------------------------------
KR121_HUMAN/24-68--------------------------------------------------------------------------------
KR101_HUMAN/71-113--------------------------------------------------------------------------------
KR103_HUMAN/84-128--------------------------------------------------------------------------------
KR105_HUMAN/60-102--------------------------------------------------------------------------------
KR105_HUMAN/199-244--------------------------------------------------------------------------------
KR106_HUMAN/265-311--------------------------------------------------------------------------------
KR104_HUMAN/349-395--------------------------------------------------------------------------------
Q08EG8_MOUSE/27-71--------------------------------------------------------------------------------
Q148I6_BOVIN/91-135--------------------------------------------------------------------------------
Q14C04_MOUSE/24-68--------------------------------------------------------------------------------
Q64526_MOUSE/118-164--------------------------------------------------------------------------------
Q6R637_CAPHI/14-56--------------------------------------------------------------------------------
Q6R637_CAPHI/57-98--------------------------------------------------------------------------------
Q8CAY5_MOUSE/64-107--------------------------------------------------------------------------------
KR412_HUMAN/110-154--------------------------------------------------------------------------------
KRA98_HUMAN/18-60--------------------------------------------------------------------------------
KRA98_HUMAN/65-109--------------------------------------------------------------------------------
KRA93_HUMAN/56-99--------------------------------------------------------------------------------
KRA92_HUMAN/32-75--------------------------------------------------------------------------------
KRA44_HUMAN/70-114--------------------------------------------------------------------------------
KRA44_HUMAN/115-159--------------------------------------------------------------------------------
KRA42_HUMAN/85-129--------------------------------------------------------------------------------
Q9D122_MOUSE/68-114--------------------------------------------------------------------------------
KR121_MOUSE/19-63--------------------------------------------------------------------------------

PF05287

KRA14_MOUSE/1-166------------------------------------------------------------------MSCNSCSGTFS.QS
KR261_HUMAN/4-210------------------------------------------------------------------PNY..CSGNSNSGS
KR134_HUMAN/1-155------------------------------------------------------------------MSYNCCSRNFSSRS
Q9D6L6_MOUSE/1-179------------------------------------------------------------------MSNNCCSEVHSSSS
Q3LI55_HUMAN/1-159------------------------------------------------------------------MSFNCSTRNCSSRP
Q05B46_BOVIN/1-155------------------------------------------------------------------MSYNCSTRTCSSRR
KR241_HUMAN/6-191------------------------------------------------------------------MSTTGYPGVCSTTS
KR151_MOUSE/1-145------------------------------------------------------------------MSYTCNSGNYSSQS
KR261_MOUSE/4-213------------------------------------------------------------------RNNCSSSGNCSSGS
Q6R646_CAPHI/1-162------------------------------------------------------------------MSYNCCSGNFSSRS
Q9D6T8_MOUSE/1-200------------------------------------------------------------------MAYSCCSGNFSSRS
KR132_HUMAN/1-170------------------------------------------------------------------MSYNCCSGNFSSRS
KR271_HUMAN/1-201------------------------------------------------------------------MPHSHC......HS
Q8K198_MOUSE/1-165------------------------------------------------------------------MSYGCYSGNFSSRS
Q9D6S9_MOUSE/1-169------------------------------------------------------------------MTYSCRSGSFSSRS

PF01500

KRA11_HUMAN/1-177SSCQPRCCETSCCQPSCCQTSFCGFPSFSTGGTCDSSCCQPSCCETSCCQPS-CYQTSS--CG-----------------
KRA3A_SHEEP/1-130TVSRPVTFVSRCTRPI......................CEP......CRRPV-CCDPCS--LQ-----------------
Q28707_RABIT/1-126QCCQP.....SCCRPTCCI................SSCCRPQCCQSVCCQPT-CCRPSC--YI-----------------
KRB2C_SHEEP/1-152SCCQPT....................................SIQTSCCQPT-CLQTSG--CE-----------------
KRA13_HUMAN/1-177S..............................................CCQPS-CCQTSS--CG-----------------
O70148_RAT/1-188SCCQPTCSQSSCCQPTCSQ................SSCCQPSCCQTSCCQPT-CCQNSS--CQ-----------------
KRB2A_SHEEP/1-172SCCQPISIQTSCCQPT..........................SIQTSCCQPT-CLQTSG--CE-----------------
KRB2D_SHEEP/1-182SCCQPTSIQTSCCQPTSIQ................TSCCQPISIQTSCCQPT-CLQTSG--CE-----------------

PF13885

KRA45_HUMAN/25-69-----------------------------------------------CCQTT.CCRTTC..CR-----------------
KRA45_HUMAN/105-150-----------------------------------------------CCRPQ.CCQSVC..CQ-----------------
A6NC61_HUMAN/114-158-----------------------------------------------CCNPC.CCQSSC..CV-----------------
D3YXB6_MOUSE/83-125-----------------------------------------------CCRPV.CCQTT...CR-----------------
KRA46_HUMAN/130-174-----------------------------------------------CCQPT.CCRPSC..CI-----------------
A0JN45_BOVIN/96-140-----------------------------------------------CCISS.PCQQDC..CE-----------------
A0JN45_BOVIN/141-186-----------------------------------------------CCEASLCSTSSC..CQ-----------------
A2A4L9_MOUSE/69-113-----------------------------------------------CCRPS.CCRPSC..CR-----------------
A2A4M0_MOUSE/24-68-----------------------------------------------CCRPS.CCVSSC..CR-----------------
A2A4M2_MOUSE/84-127-----------------------------------------------CCQP..CCQPSC..CQ-----------------
A2A5X3_MOUSE/75-120-----------------------------------------------CCSPP.CCQPSC..CE-----------------
A2A5X3_MOUSE/232-274-----------------------------------------------CCRTT.CCKPTC..VI-----------------
KR10D_MOUSE/88-132-----------------------------------------------CAQPV.CCEATI..CE-----------------
A4IF42_MOUSE/141-185-----------------------------------------------CCKPC.CCQSSC..CK-----------------
A6NFW2_HUMAN/170-213-----------------------------------------------CCKPY.CCQSSC..CK-----------------
KR108_BOVIN/111-155-----------------------------------------------CCRPV.CCRPVC..CT-----------------
A6QQG8_BOVIN/23-64-----------------------------------------------CCPPT.CYQTS....E-----------------
A6QQG8_BOVIN/120-162-----------------------------------------------CCKPT.CV.TTC..CQ-----------------
A8MPS1_HUMAN/106-150-----------------------------------------------CSKPC.CCQSSC..CQ-----------------
KR10D_HUMAN/68-112-----------------------------------------------CAQPL.CCDPVI..CE-----------------
KR10D_HUMAN/128-172-----------------------------------------------CCQPV.CFEATV..CE-----------------
KR10D_HUMAN/193-237-----------------------------------------------LCKSS.CCQPVV..CE-----------------
KRA96_HUMAN/80-124-----------------------------------------------CCSTP.CYQPIC..CG-----------------
KR291_HUMAN/115-159-----------------------------------------------CCQEK.CCDASP..CQ-----------------
KR291_HUMAN/165-209-----------------------------------------------SCPET.SCLPTI..CT-----------------
KRA91_HUMAN/37-79-----------------------------------------------CCQPS.CCVPSC..CQ-----------------
KRA91_HUMAN/80-122-----------------------------------------------CCSTP.CCQPTC..CG-----------------
A8QW00_BOVIN/128-172-----------------------------------------------PCQQA.CCEPVC..CT-----------------
B1AQ90_MOUSE/24-68-----------------------------------------------CCQTT.CCRTTC..CR-----------------
B1AQ90_MOUSE/79-123-----------------------------------------------CCQSV.CCQPTC..CR-----------------
B1AQA8_MOUSE/109-152-----------------------------------------------CCRPS.CCRPSC..CV-----------------
B1AQA9_MOUSE/24-68-----------------------------------------------CCQTT.CCRTTC..CR-----------------
B1AQA9_MOUSE/178-222-----------------------------------------------CCRPC.CGSSSC..CG-----------------
B6CQV3_CAPHI/24-66-----------------------------------------------CCQP..CCPTTC..CQ-----------------
B9EIL2_HUMAN/41-85-----------------------------------------------CCEPP.CCAPSC..CA-----------------
D2HB39_AILME/26-71-----------------------------------------------CSAPS.CCQPSP..CS-----------------
D2HIQ1_AILME/153-197-----------------------------------------------PCMPV.PCQPST..CV-----------------
D2HIQ2_AILME/193-237-----------------------------------------------TCKPS.CCQSVI..CE-----------------
D2HIQ2_AILME/253-297-----------------------------------------------CCDPS.PCEPSC..SE-----------------
D2HJK5_AILME/29-73-----------------------------------------------SCQTT.CYVPSS..CQ-----------------
D2HR47_AILME/5-49-----------------------------------------------CCGSV.CSDQGC..GQ-----------------
D2HR48_AILME/30-74-----------------------------------------------CCRTT.CCRPSC..CV-----------------
D3YXB3_MOUSE/75-119-----------------------------------------------CCRPS.CCISSC..CR-----------------
D3Z5T3_MOUSE/78-123-----------------------------------------------CCTPS.CCQQSS..CQ-----------------
D3ZD90_RAT/24-64-----------------------------------------------CWRPS.CV.TSC..CQ-----------------
D3ZD90_RAT/103-146-----------------------------------------------CCQSS.CCQPSC..CQ-----------------
D3ZDA4_RAT/130-174-----------------------------------------------CCRPS.CDKTTC..CR-----------------
D3ZDD4_RAT/137-184-----------------------------------------------CCVPV.CCRPVC..CT-----------------
D3ZDT9_RAT/84-128-----------------------------------------------CCRPS.CCTSSC..CR-----------------
D3ZDU4_RAT/27-71-----------------------------------------------CCEPC.SCAPSC..CQ-----------------
D3ZEA5_RAT/163-207-----------------------------------------------CCAPV.CCQCKI..CT-----------------
D3ZGU7_RAT/27-65-----------------------------------------------CCEPC.GCAPSC..CQ-----------------
D3ZJ72_RAT/72-115-----------------------------------------------CCDTA.CCDSKC..CK-----------------
D3ZKB5_RAT/71-114-----------------------------------------------CCRPV.CCQTTC..CQ-----------------
D3ZMN9_RAT/29-73-----------------------------------------------CCRTT.CCRPSC..CV-----------------
D3ZMN9_RAT/133-177-----------------------------------------------CCRPC.CGSSSC..CG-----------------
D3ZMV5_RAT/79-121-----------------------------------------------CCVSS.CCQP.C..CR-----------------
D3ZNL6_RAT/173-218-----------------------------------------------GCGSS.CCQSSC..CK-----------------
D3ZNY7_RAT/180-226-----------------------------------------------CCQPS.CCVTLC..CR-----------------
D3ZRR1_RAT/101-148-----------------------------------------------CCVPS.CCQPSC..CQ-----------------
D3ZTU8_RAT/141-185-----------------------------------------------CCQSS.CCKPCC..CQ-----------------
D3ZUG4_RAT/130-173-----------------------------------------------CCKPV.CCTP.I..CS-----------------
D3ZV25_RAT/47-91-----------------------------------------------CCRPS.CCQSVC..CQ-----------------
D3ZV25_RAT/107-151-----------------------------------------------CCQSV.CCRPSC..CI-----------------
D4A2F4_RAT/27-71-----------------------------------------------CCEPC.GCVPSC..CQ-----------------
D4A2F4_RAT/73-117-----------------------------------------------CVSSP.CCTPSC..CQ-----------------
D4A3Q1_RAT/42-85-----------------------------------------------CCEPC.GCAPSC..CQ-----------------
D4A5R4_RAT/44-88-----------------------------------------------CCRPQ.CCQSVC..CQ-----------------
D4A8A6_RAT/73-116-----------------------------------------------CCRPV.CCQTTC..CQ-----------------
D4A8P6_RAT/91-136-----------------------------------------------SCQPA.CCTSSP..CQ-----------------
D4A8T7_RAT/139-184-----------------------------------------------CGVTL.CCRPVC..CT-----------------
KR121_HUMAN/24-68-----------------------------------------------CYIPV.GCQSSV..CV-----------------
KR101_HUMAN/71-113-----------------------------------------------CTS...SCTPSC..CQ-----------------
KR103_HUMAN/84-128-----------------------------------------------SCQPA.CCTSSP..CQ-----------------
KR105_HUMAN/60-102-----------------------------------------------PCQSG.CT..SS..CT-----------------
KR105_HUMAN/199-244-----------------------------------------------CCQQS.SCQPAC..CT-----------------
KR106_HUMAN/265-311-----------------------------------------------PCQHA.CCVPVCSGAS-----------------
KR104_HUMAN/349-395-----------------------------------------------CCTTS.CCRPSS..SV-----------------
Q08EG8_MOUSE/27-71-----------------------------------------------CCEPC.CCAPSC..CQ-----------------
Q148I6_BOVIN/91-135-----------------------------------------------SCQSA.CCTSSP..CQ-----------------
Q14C04_MOUSE/24-68-----------------------------------------------CCVSS.CCRPQC..CQ-----------------
Q64526_MOUSE/118-164-----------------------------------------------CCQP..CCRPSC..CQ-----------------
Q6R637_CAPHI/14-56-----------------------------------------------CCRTT.CSEFSC..CQ-----------------
Q6R637_CAPHI/57-98-----------------------------------------------CCSKP.CCQPTC..CE-----------------
Q8CAY5_MOUSE/64-107-----------------------------------------------CCPPT.CCDPAS..CD-----------------
KR412_HUMAN/110-154-----------------------------------------------CCRTT.CCRPSC..CV-----------------
KRA98_HUMAN/18-60-----------------------------------------------CWKPT.TV.TTC..SS-----------------
KRA98_HUMAN/65-109-----------------------------------------------CCQPS.CCSTPC..CQ-----------------
KRA93_HUMAN/56-99-----------------------------------------------CCRTT.CCQPI...CV-----------------
KRA92_HUMAN/32-75-----------------------------------------------CSSTP.CCQPAC..CV-----------------
KRA44_HUMAN/70-114-----------------------------------------------CCRPQ.CCQSVC..CQ-----------------
KRA44_HUMAN/115-159-----------------------------------------------CCQPT.CCCPSY..CV-----------------
KRA42_HUMAN/85-129-----------------------------------------------CFRPQ.CCQSVY..CQ-----------------
Q9D122_MOUSE/68-114-----------------------------------------------CCQPT.CCRPSC..CI-----------------
KR121_MOUSE/19-63-----------------------------------------------SCQPS.CCVSSP..CQ-----------------

PF05287

KRA14_MOUSE/1-166FGGQLQYPISSCGS..SYPNNVFYSTDLQTPITHQLGSSLHSGCQETFCEPT-NCQTAY--VV.................
KR261_HUMAN/4-210LRTSRHIPLTSID...LCPTSVSCGDVLYLPTSSQDHTWVTDNCQETCGEPT-SCQPVH--CE..............TGN
KR134_HUMAN/1-155FGGYLYYPG.......SYPSSLVYSTALCSPSTCQLRSSLYRDCQKTCWEP.-......--...................
Q9D6L6_MOUSE/1-179CRNSSHVPVTSPVTSGVCSTETRGKDAPCSPTSSQGSNTPRDNCQEPCGEPR-SCQSTS--CN.................
Q3LI55_HUMAN/1-159IGGRCIVPVAQVTT..TSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPT-ACQPTC--YQ.................
Q05B46_BOVIN/1-155IGGEYTVPVATVST.....PDADCLSGIYLPSSFQTGSWLLDHCQETCCEPT-LCQSTC--YQ.................
KR241_HUMAN/6-191YRTHCYIPVTSSVT..LSSSDLSPTFGHCLPSSYQGNLWLLDYCQESYGEAP-TCKSPS--CE.................
KR151_MOUSE/1-145FGGFLRQPVSTYNS..FYPT....SNVVYSPKNFQLGSSFYNGQQETFSEPL-EGHLPC--VG.................
KR261_MOUSE/4-213LRNTCHIPASSSIA..LCSTNMGCGEVFCVPSSCQDHTWFMDNCPETFAEPL-SGQPPS--RE..............ASG
Q6R646_CAPHI/1-162LRDHLRYSGSSCGS..SFPSNLVYRTDLYSPSSCQLGSSLYS..QETCCEPI-RTQTVV--...................
Q9D6T8_MOUSE/1-200LRSCLPSSGSCRGS..SYPSNLVYTTTSCSPSTCQLSSSVRSGCQESCIEPI-RCQESC--IEPIRCQETYIEPIRCQES
KR132_HUMAN/1-170CGDYLRYPASSRGF..SYPSNLVYSTDLCSPSTCQLGSSLYRGCQEICWEPT-SCQTSY--VE.................
KR271_HUMAN/1-201LRSFHNAPPLSAIT..HGTNPITFEDRLCLPSSFHSRTCFLDNFQETCNETT-SCQMTN--CEQDLFTDDSCVQSNCFPG
Q8K198_MOUSE/1-165SGDHLSYPHSSCGS..SYPSHLLQSTRFYSPGTCHLGSSLHSGCQQNCFQPI-RCQTSH--VV.................
Q9D6S9_MOUSE/1-169YGGQLCYP.SSCGS..SFPRQLTHRTNFCSPRNRHLGSSFRHGYHQNCFQPI-RCQTSH--VV.................

PF01500

KRA11_HUMAN/1-177-------------TGCGIGGGIGYGQEGSSGAVSTRIRWC-RPDCRVEGTCLPPCC--V-VSCTPP-SC------CQ--L
KRA3A_SHEEP/1-130-------------EGC.......................C-RPITCCPTSCQAVVC--R-PCCWAT-TC------CQ--P
Q28707_RABIT/1-126-------------SSC.......................C-RPTCCRPTCCRPTCC--R-PTSCQT-TC------CR--T
KRB2C_SHEEP/1-152-------------TGCGIGGSTGYGQVGSSGAVSSRTRWC-RPDCRVEGTSLPPCC--V-VSCTSP-SC------CQ--L
KRA13_HUMAN/1-177-------------TGCGIGGGIGYGQEGSSGAVSTRIRWC-RPDCRVEGTCLPPCC--V-VSCTPP-TC------CQ--L
O70148_RAT/1-188-------------TSC...CGTGSGQEGGSGATSCRVRWC-RPDCRVEGTCLPPCC--V-VSCTPP-TC------CQ--L
KRB2A_SHEEP/1-172-------------TGCGIGGSIGYGQVGSSGAVSSRTRWC-RPDCRVEGTSLPPCC--V-VSCTPP-SC------CQ--L
KRB2D_SHEEP/1-182-------------TGCGIGGSIGYGQVGSSGAVSSRTKWC-RPDCRVEGTSLPPCC--V-VSCTSP-SC------CQ--L

PF13885

KRA45_HUMAN/25-69-------------PSC-----------------------C.KP..QC...CQSVCY..Q.PTCCHP.SC...--.CI..S
KRA45_HUMAN/105-150-------------PTC-----------------------C.RP..SC...CISSCC..H.PSCCES.SC...--.CR..P
A6NC61_HUMAN/114-158-------------PVC-----------------------C.QS..SC...CKPCCC..Q.SSCCVP.SS...--.CC..R
D3YXB6_MOUSE/83-125-------------PSC-----------------------G.VS..SC...CRPVCC..Q.TTC.RP.SC...--.GV..S
KRA46_HUMAN/130-174-------------SSC-----------------------C.RP..SC...CESSCC..R.PCCCRP.CC...--.CL..R
A0JN45_BOVIN/96-140-------------PVC-----------------------C.RP..VC...CKPVCR..T.PVCCTP.VC...--.CR..P
A0JN45_BOVIN/141-186-------------QSS-----------------------C.QP..PC...CTSSPC..Q.QACCEP.IC...--.CT..P
A2A4L9_MOUSE/69-113-------------PSC-----------------------C.RP..SC...CQPSCC..V.SSCCKP.SC...--.CV..S
A2A4M0_MOUSE/24-68-------------PQC-----------------------C.QS..VC...CQPTCC..H.PSCCIS.SC...--.RV..S
A2A4M2_MOUSE/84-127-------------SSC-----------------------C.QP..SC...CQPSCC..Q.SSCCQP.SC...--.CQ..S
A2A5X3_MOUSE/75-120-------------TTC-----------------------Y.RT.TCC...CYKPTC..A.TNCCQP.SC...--.YE..T
A2A5X3_MOUSE/232-274-------------.SC-----------------------C.QP..SC...CETTCC..R.TTCCKP.TC...--.VI..S
KR10D_MOUSE/88-132-------------PSC-----------------------S.MG..SC...CQPVCC..E.ATICEP.SC...--.SV..S
A4IF42_MOUSE/141-185-------------PCC-----------------------C.QS..SC...CKPCCC..Q.SSCCKP.CC...--.CQ..S
A6NFW2_HUMAN/170-213-------------P.C-----------------------C.SS..SG...CGSSCC..Q.SSCCNP.CC...--.SQ..S
KR108_BOVIN/111-155-------------PVC-----------------------C.RP..VC...CRPVCC..R.PVCCRP.VC...--.CT..P
A6QQG8_BOVIN/23-64-------------NTC-----------------------C.RT..TC...CKPTCV....TTCCQP.NC...--.GR..S
A6QQG8_BOVIN/120-162-------------PNC-----------------------G.RS..SC...CQP.CC..R.PIRCQT.TC...--.CR..T
A8MPS1_HUMAN/106-150-------------SSC-----------------------C.KP..CC...CQSSCC..Q.SSCFKP.CC...--.CQ..S
KR10D_HUMAN/68-112-------------PSC-----------------------S.VS..SG...CQPVCC..E.ATTCEP.SC...--.SV..S
KR10D_HUMAN/128-172-------------PSC-----------------------S.VS..SC...AQPVCC..E.PAICEP.SC...--.SV..S
KR10D_HUMAN/193-237-------------PSC-----------------------C.SA..VC...TLPSSC..Q.PVVCEP.SC...--.CQ..P
KRA96_HUMAN/80-124-------------SSC-----------------------C.GQ..TS...CGSSCG..Q.SSSCAP.VY...--.CR..R
KR291_HUMAN/115-159-------------QSS-----------------------C.QE..SV...CMSGSC..Q.AACGQS.VC...--.CD..A
KR291_HUMAN/165-209-------------ASP-----------------------C.QP..TW...CQGSSC..Q.PVSGEG.QP...--.CK..S
KRA91_HUMAN/37-79-------------P.C-----------------------C.HP..TC...CQNTCC..R.TTCCQP.TC...--.VA..S
KRA91_HUMAN/80-122-------------SSC-----------------------C.GQ..TS...CGSSCC..Q.PIC.GS.SC...--.CQ..P
A8QW00_BOVIN/128-172-------------PVC-----------------------C.RP..VC...CTPVCC..R.PVCCTP.VC...--.CT..P
B1AQ90_MOUSE/24-68-------------PSC-----------------------C.VS..SC...CRPQCC..Q.SVCCQP.TC...--.CR..P
B1AQ90_MOUSE/79-123-------------PSC-----------------------C.RP..SC...CISSCC..Q.PSCGSS.SC...--.CG..S
B1AQA8_MOUSE/109-152-------------SSC-----------------------C.RP..SC...CISSCC..R.P.CCRP.CC...--.GS..S
B1AQA9_MOUSE/24-68-------------PSC-----------------------C.VS..SC...CRPSCC..V.SSCCRP.QC...--.CQ..S
B1AQA9_MOUSE/178-222-------------SSC-----------------------C.RP..SC...CRPSCC..V.SSCCRP.QC...--.CI..S
B6CQV3_CAPHI/24-66-------------TTC-----------------------C.RT..TC...CKPTCV....TSCCQP.TC...--.CE..S
B9EIL2_HUMAN/41-85-------------PAP-----------------------C.LS..LV...CTPVSR..V.SSPCCP.VT...--.CE..P
D2HB39_AILME/26-71-------------SSC-----------------------C.TP..SS...CVSLLC..R.PVC.RP.AC...--.CV..P
D2HIQ1_AILME/153-197-------------FSS-----------------------C.NP..TC...YVSSPC..Q.PLHCQP.AP...--.SI..S
D2HIQ2_AILME/193-237-------------PSC-----------------------C.SA..VC...TVPTSC..Q.PVVCEP.TC...--.GQ..P
D2HIQ2_AILME/253-297-------------SSN-----------------------C.QP..AS...CVALVC..E.PVCLRP.VC...--.CI..S
D2HJK5_AILME/29-73-------------TTC-----------------------Y.VP..SS...CQVSCC..V.PSSCQA.SC...--.SM..P
D2HR47_AILME/5-49-------------ETC-----------------------C.HP..TC...CQTTCC..R.TTCCRP.SC...--.CV..S
D2HR48_AILME/30-74-------------SSC-----------------------C.RP..SC...GGSSCW..G.SSCCRP.SC...--.CI..S
D3YXB3_MOUSE/75-119-------------PSC-----------------------C.RP..SC...CVSSCC..R.PQCCQS.LC...--.CQ..P
D3Z5T3_MOUSE/78-123-------------PAC-----------------------C.TC..SP...CQPSCC..V.TLCCKP.VC...--.CT..P
D3ZD90_RAT/24-64-------------P.C-----------------------C.QP..SC...CGSSCC..Q.P.CCQT.TC...--.CR..T
D3ZD90_RAT/103-146-------------SSC-----------------------C.QP..RC...CISSCC..Q.P.CCQS.SC...--.CQ..P
D3ZDA4_RAT/130-174-------------TTC-----------------------C.RP..SC...CVSSCC..R.PSCCRP.SC...--.CV..S
D3ZDD4_RAT/137-184-------------PIC-----------------------S.ASSSSC...CQPSCC..APPVCCKP.CS...--.SL..S
D3ZDT9_RAT/84-128-------------PCC-----------------------C.RP..SC...CISSCC..R.PSCCIS.SC...--.CR..P
D3ZDU4_RAT/27-71-------------PSC-----------------------C.AP..C....CAPSCC..V.PSCCHC.SA...--.PT..P
D3ZEA5_RAT/163-207-------------PAC-----------------------C.KS..SC...CSPSCC..Q.SSCCKP.CC...--.CQ..S
D3ZGU7_RAT/27-65-------------TSC-----------------------CCQA..SC...CAPSCC..A.PT......P...--.CL...
D3ZJ72_RAT/72-115-------------PTC-----------------------V..S..IC...CSTPCC..Q.PSCCVP.SC...--.CV..P
D3ZKB5_RAT/71-114-------------SSC-----------------------C.RP..TT...CRPSCG..V.SSCCRP.VC...--.CQ..T
D3ZMN9_RAT/29-73-------------SSC-----------------------C.RP..SC...CVSSCC..R.PSCCQS.VC...--.CQ..P
D3ZMN9_RAT/133-177-------------SSC-----------------------C.RP..TC...CISSCC..R.PSCCCP.SC...--.CV..S
D3ZMV5_RAT/79-121-------------PSC-----------------------C.QP..C....CRPSCC..E.SSCCQP.RC...--.CI..S
D3ZNL6_RAT/173-218-------------PCC-----------------------C.QS..SC...CKPCCC..Q.SSCCKP.CC...--.SS..G
D3ZNY7_RAT/180-226-------------PVC-----------------------C.TP..ICS.ASSSSCC..Q.PSCCAP.VC...--.CK..P
D3ZRR1_RAT/101-148-------------L.C-----------------------F.LP..TC...CETSCC..K.TTSIKP.TCVVL--GCS..T
D3ZTU8_RAT/141-185-------------SSC-----------------------C.KS..SC...CKPCCC..Q.SSCCKP.CC...--.SS..S
D3ZUG4_RAT/130-173-------------ESC-----------------------C.QQ..SS...CQSSCC..Q.PSCCVP.VC...--.CR..P
D3ZV25_RAT/47-91-------------PTC-----------------------C.RP..SC...CVSSCC..Q.PTCCRP.SC...--.CI..S
D3ZV25_RAT/107-151-------------SSC-----------------------C.RP..SC...CRPSCC..V.SSCCRP.SC...--.CI..S
D4A2F4_RAT/27-71-------------PSC-----------------------C.VP..CC...CQSSCC..A.PSCCAP.AP...--.CL..T
D4A2F4_RAT/73-117-------------QSS-----------------------C.QP..AC...CTCSPC..Q.QSCGVT.LC...--.CK..P
D4A3Q1_RAT/42-85-------------PSC-----------------------C.VP..C....CAPSCC..V.PSCCQA.SC...--.CA..P
D4A5R4_RAT/44-88-------------PTC-----------------------C.RP..SC...CRPSCC..I.SSCCRP.SC...--.CR..P
D4A8A6_RAT/73-116-------------SSC-----------------------C.RP..VC...CQTT.C..R.PSCGVS.SC...--.CR..P
D4A8P6_RAT/91-136-------------PSC-----------------------C.AP..VC...CKPVCC..KPPSCCVP.VC...--.CR..P
D4A8T7_RAT/139-184-------------PIC-----------------------SGSP..SC...CAPVCC..K.PVCCKP.CS...--.SL..S
KR121_HUMAN/24-68-------------PVS-----------------------F.KP..AV...CVPVRC..Q.SSVCVP.VS...--.CR..P
KR101_HUMAN/71-113-------------QSS-----------------------C.QP..AC...CTSSPC..Q.QACCVP.VC...--.CK..P
KR103_HUMAN/84-128-------------QAC-----------------------C.VP..VC...CKPVCC..V.PVCCKP.VC...--.CK..P
KR105_HUMAN/60-102-------------PSC-----------------------C.QP..AC...CASSPC..Q.QACCVP.VC...--.CK..P
KR105_HUMAN/199-244-------------TSC-----------------------C.RP..SS...SVSLLC..R.PIC.RP.AC...--.CVPIS
KR106_HUMAN/265-311-------------TSC-----------------------C.QQ..SS...CQPACC..T.ASCCRP.SS...--.SV..S
KR104_HUMAN/349-395-------------SLL-----------------------C.RP..V....CRPACCVPV.PSCCAPTSS...--.CQ..P
Q08EG8_MOUSE/27-71-------------PSC-----------------------C.QP..SC...CVPSCC..A.PSCCVP.SC...--.CQ..P
Q148I6_BOVIN/91-135-------------QAC-----------------------C.EP..VC...CRPVSC..T.PVCCTP.VY...--.CR..P
Q14C04_MOUSE/24-68-------------SVC-----------------------C.QP..TC...CRPSCC..I.SSCCRP.SC...--.CR..P
Q64526_MOUSE/118-164-------------SSC-----------------------C.RP..CCQPFCLNLCC..Q.PACSGP.VT...--.CT..R
Q6R637_CAPHI/14-56-------------P.C-----------------------C.PP..TC...CQTTCC..R.TTCCKP.TC...--.VT..S
Q6R637_CAPHI/57-98-------------SIC-----------------------C.QP..S....CPPACY..Q.TS..ET.TC...--.CR..T
Q8CAY5_MOUSE/64-107-------------SNC-----------------------C.KP..T....CVTICC..S.TPCCQP.SC...--.CV..P
KR412_HUMAN/110-154-------------SSC-----------------------C.RP..QC...CQSVCC..Q.PTCCRP.SC...--.CI..S
KRA98_HUMAN/18-60-------------TPC-----------------------C.QP..SC...CVSSCC..Q.P.CCRP.TC...--.CQ..N
KRA98_HUMAN/65-109-------------PTC-----------------------C.GQ..TS...CGSSCG..Q.SSSCAP.VY...--.CR..R
KRA93_HUMAN/56-99-------------TSC-----------------------C.QP..SC...CSTPCC..Q.PTCCGS.SC...--.GQ..S
KRA92_HUMAN/32-75-------------SSC-----------------------C.QP..C....CRPTCC..Q.NTCCRT.TC...--.CQ..P
KRA44_HUMAN/70-114-------------PTC-----------------------C.RP..QC...CQTTCC..R.TTCCRP.SC...--.CR..P
KRA44_HUMAN/115-159-------------SSC-----------------------C.RP..QC...CQTTCC..R.TTCCRP.SC...--.CV..S
KRA42_HUMAN/85-129-------------PTC-----------------------C.RP..SC...GQTTCC..R.TTCYRP.SC...--.CV..S
Q9D122_MOUSE/68-114-------------SSC-----------------------C.QP..SC...GSSSCC..G.SSCCRP.CCR..--PCC..S
KR121_MOUSE/19-63-------------ASC-----------------------F.VS..SP...CQPSCC..V.SSSCQS.AC...--.CR..P

PF05287

KRA14_MOUSE/1-166.............SRP-----------------------CQRPFYSQRIRGPCRPC--Q-STFSGSLGFGSR..GFQ--S
KR261_HUMAN/4-210LETSCGSSTAYYVPRP-----------------------CQGSSFLPA.SFFSSSC--L-PVSCRPQRYVSS..GCR--P
KR134_HUMAN/1-155..............AS-----------------------CQKSCYRPRTSILCCPC--Q-TTCSGSLGFRSS..SCR--S
Q9D6L6_MOUSE/1-179...RSTGSPSVCSPIT-----------------------SGISGSQEGTSCLPNTP--R-HSSFGRPAFCRQPMSCY--V
Q3LI55_HUMAN/1-159........RTSCVSNP-----------------------CQVTCSRQT.TCISNPC--S-TTYSRPLTFVSS..GCQ--P
Q05B46_BOVIN/1-155........PAPCVSNP-----------------------VQVT.SRQT.TCVSSPY--S-TTCSRPVTFVSS..GCQ--P
KR241_HUMAN/6-191...PKTCSTTGCDPSN-----------------------SSVPCNSPSAGQVFSVC--E-TTNVSPSPSCSP..STQ--T
KR151_MOUSE/1-145.............SAS-----------------------FHTSCFRPK.QYFSSPC--Q-GGFTGSFGYGNT..GFG--A
KR261_MOUSE/4-213FENSCCSST.YCVPRH-----------------------CQGSGYIPASSFISGSC--L-PASYRPVSYVSS..SCR--P
Q6R646_CAPHI/1-162.............SSP-----------------------CQTSCYRPRTSTFFSPC--Q-TTCSGSLGFGSS..NLQ--S
Q9D6T8_MOUSE/1-200CIEPIRCQRSCVVPSP-----------------------CQKPCYYPRSSTPCRPC--Q-GTYAGSLGFGSR..SCS--S
KR132_HUMAN/1-170.............SSP-----------------------CQTSCYRPRTSLLCSPC--K-TTYSGSLGFGSS..SCR--S
KR271_HUMAN/1-201VVQTTYSNSRPCERTA-----------------------CQSESSSAGLACVSQPC--Q-SESTQQMGFVAQ..SCQ--P
Q8K198_MOUSE/1-165.............HSS-----------------------CQRPCYSPRVSSVCSPC--R-TTYAGSQSFGSS..SCH--S
Q9D6S9_MOUSE/1-169.............HSS-----------------------CQRPCYRPSVSSFCSPC--R-ATYAGFLGFRSS..SCH--S

PF01500

KRA11_HUMAN/1-177HHA----------EAS--CC-RPSY-CGQSCCRPVC.......CCY............C---------SEPTC-------
KRA3A_SHEEP/1-130VSV----------QCP--CC-RPTS-C.PSAPRTTCRTFRTSPC...............---------....C-------
Q28707_RABIT/1-126...----------..Q--CC-RPSC-CVSTCCRPCC...SSGSC...............---------....C-------
KRB2C_SHEEP/1-152YYA----------QAS--CC-RPSY-CGQSCCRPAC.......CCQPTCTEPVC.EPTC---------SQPIC-------
KRA13_HUMAN/1-177HHA----------EAS--CC-RPSY-CGQSCCRPVC.......CCY............S---------CEPTC-------
O70148_RAT/1-188HHA----------QAS--CC-RPSY-CGQSCCRPAC.......CCH..CCEPSCSKPSC---------SEPSC-------
KRB2A_SHEEP/1-172YYA----------QAS--CC-RPSY-CGQSCCRPAC.......CCQPTCIEPIC.EPSC---------CEPTC-------
KRB2D_SHEEP/1-182YYA----------QAS--CC-RPSY-CGQSCCRPAC.......CCQPTCIEPVC.EPTC---------CEPTC-------

PF13885

KRA45_HUMAN/25-69---------------S..CC.RP-------------------------------------------------Y-------
KRA45_HUMAN/105-150---------------C..CCVRP-------------------------------------------------V-------
A6NC61_HUMAN/114-158---------------S..CC.SK-------------------------------------------------S-------
D3YXB6_MOUSE/83-125---------------S..CC.RP-------------------------------------------------V-------
KRA46_HUMAN/130-174---------------P..VC.GR-------------------------------------------------V-------
A0JN45_BOVIN/96-140---------------V..CC.TP-------------------------------------------------V-------
A0JN45_BOVIN/141-186---------------V..CC.RP-------------------------------------------------V-------
A2A4L9_MOUSE/69-113---------------S..CC.RP-------------------------------------------------S-------
A2A4M0_MOUSE/24-68---------------S..CC.CP-------------------------------------------------S-------
A2A4M2_MOUSE/84-127---------------S..CC.QP-------------------------------------------------R-------
A2A5X3_MOUSE/75-120---------------T..CC.KP-------------------------------------------------A-------
A2A5X3_MOUSE/232-274---------------...CC.QP-------------------------------------------------S-------
KR10D_MOUSE/88-132---------------T..CA.QP-------------------------------------------------V-------
A4IF42_MOUSE/141-185---------------S..CC.RP-------------------------------------------------C-------
A6NFW2_HUMAN/170-213---------------S..CC.VP-------------------------------------------------V-------
KR108_BOVIN/111-155---------------V..CC.RP-------------------------------------------------M-------
A6QQG8_BOVIN/23-64---------------S..CC.QP-------------------------------------------------C-------
A6QQG8_BOVIN/120-162---------------T..CL.KP-------------------------------------------------I-------
A8MPS1_HUMAN/106-150---------------S..CC.VP-------------------------------------------------V-------
KR10D_HUMAN/68-112---------------N..CY.QP-------------------------------------------------V-------
KR10D_HUMAN/128-172---------------S..CC.QP-------------------------------------------------V-------
KR10D_HUMAN/193-237---------------V..CP.TP-------------------------------------------------T-------
KRA96_HUMAN/80-124---------------T..CY.HP-------------------------------------------------T-------
KR291_HUMAN/115-159---------------G..SC.QP-------------------------------------------------S-------
KR291_HUMAN/165-209---------------T..YY.QP-------------------------------------------------I-------
KRA91_HUMAN/37-79---------------...CC.QP-------------------------------------------------S-------
KRA91_HUMAN/80-122---------------...CC.HP-------------------------------------------------T-------
A8QW00_BOVIN/128-172---------------V..CC.RP-------------------------------------------------V-------
B1AQ90_MOUSE/24-68---------------S..CC.RP-------------------------------------------------S-------
B1AQ90_MOUSE/79-123---------------S..CC.RP-------------------------------------------------C-------
B1AQA8_MOUSE/109-152---------------S..CC.GS-------------------------------------------------S-------
B1AQA9_MOUSE/24-68---------------V..CC.QP-------------------------------------------------T-------
B1AQA9_MOUSE/178-222---------------S..CC.RP-------------------------------------------------T-------
B6CQV3_CAPHI/24-66---------------I..CC.QP-------------------------------------------------S-------
B9EIL2_HUMAN/41-85---------------S..PC.QS-------------------------------------------------G-------
D2HB39_AILME/26-71---------------ASPCC.AP-------------------------------------------------A-------
D2HIQ1_AILME/153-197---------------F..IC.QP-------------------------------------------------V-------
D2HIQ2_AILME/193-237---------------V..CP.TP-------------------------------------------------S-------
D2HIQ2_AILME/253-297---------------S..PC.EP-------------------------------------------------P-------
D2HJK5_AILME/29-73---------------V..IC.RP-------------------------------------------------A-------
D2HR47_AILME/5-49---------------S..CC.RP-------------------------------------------------S-------
D2HR48_AILME/30-74---------------S..CC.RP-------------------------------------------------S-------
D3YXB3_MOUSE/75-119---------------T..CC.RP-------------------------------------------------S-------
D3Z5T3_MOUSE/78-123---------------I.CCC.VP-------------------------------------------------V-------
D3ZD90_RAT/24-64---------------...CF.QP-------------------------------------------------S-------
D3ZD90_RAT/103-146---------------S..CC.KP-------------------------------------------------C-------
D3ZDA4_RAT/130-174---------------S..CC.RP-------------------------------------------------S-------
D3ZDD4_RAT/137-184---------------L..LC.RP-------------------------------------------------V-------
D3ZDT9_RAT/84-128---------------S..CC.RP-------------------------------------------------C-------
D3ZDU4_RAT/27-71---------------C.LLC.TP-------------------------------------------------V-------
D3ZEA5_RAT/163-207---------------S..CC.KP-------------------------------------------------C-------
D3ZGU7_RAT/27-65---------------...LC.TP-------------------------------------------------V-------
D3ZJ72_RAT/72-115---------------S..CC.QP-------------------------------------------------S-------
D3ZKB5_RAT/71-114---------------...TC.RP-------------------------------------------------S-------
D3ZMN9_RAT/29-73---------------T..CC.RP-------------------------------------------------S-------
D3ZMN9_RAT/133-177---------------G..CC.RP-------------------------------------------------H-------
D3ZMV5_RAT/79-121---------------S..CC.QP-------------------------------------------------C-------
D3ZNL6_RAT/173-218---------------S.GCN.DP-------------------------------------------------M-------
D3ZNY7_RAT/180-226---------------V..SC.KP-------------------------------------------------C-------
D3ZRR1_RAT/101-148---------------P..CC.QP-------------------------------------------------C-------
D3ZTU8_RAT/141-185---------------S..CN.AP-------------------------------------------------M-------
D3ZUG4_RAT/130-173---------------V..CC.TP-------------------------------------------------I-------
D3ZV25_RAT/47-91---------------S..CC.RP-------------------------------------------------S-------
D3ZV25_RAT/107-151---------------S..CC.RP-------------------------------------------------C-------
D4A2F4_RAT/27-71---------------L..IC.TP-------------------------------------------------V-------
D4A2F4_RAT/73-117---------------V..CC.VP-------------------------------------------------V-------
D4A3Q1_RAT/42-85---------------S..CC.TP-------------------------------------------------T-------
D4A5R4_RAT/44-88---------------S..CC.VP-------------------------------------------------Q-------
D4A8A6_RAT/73-116---------------V..CC.QT-------------------------------------------------T-------
D4A8P6_RAT/91-136---------------V..CC.TP-------------------------------------------------I-------
D4A8T7_RAT/139-184---------------L..LC.RP-------------------------------------------------V-------
KR121_HUMAN/24-68---------------V..VY.AA-------------------------------------------------P-------
KR101_HUMAN/71-113---------------V..CC.LP-------------------------------------------------T-------
KR103_HUMAN/84-128---------------I..CC.VP-------------------------------------------------V-------
KR105_HUMAN/60-102---------------V..CC.LP-------------------------------------------------T-------
KR105_HUMAN/199-244---------------S..CC.AP-------------------------------------------------A-------
KR106_HUMAN/265-311---------------L..LC.HP-------------------------------------------------V-------
KR104_HUMAN/349-395---------------S..CC.RP-------------------------------------------------A-------
Q08EG8_MOUSE/27-71---------------S..CC.AP-------------------------------------------------A-------
Q148I6_BOVIN/91-135---------------V..CC.ES-------------------------------------------------S-------
Q14C04_MOUSE/24-68---------------S..CC.RP-------------------------------------------------S-------
Q64526_MOUSE/118-164---------------T..CY.QP-------------------------------------------------T-------
Q6R637_CAPHI/14-56---------------...CC.QP-------------------------------------------------T-------
Q6R637_CAPHI/57-98---------------T..CH.KP-------------------------------------------------T-------
Q8CAY5_MOUSE/64-107---------------T..CC.QP-------------------------------------------------S-------
KR412_HUMAN/110-154---------------S..SC.CP-------------------------------------------------S-------
KRA98_HUMAN/18-60---------------T..CC.QP-------------------------------------------------I-------
KRA98_HUMAN/65-109---------------T..CY.HP-------------------------------------------------T-------
KRA93_HUMAN/56-99---------------S..SC.AP-------------------------------------------------V-------
KRA92_HUMAN/32-75---------------T..CV.TS-------------------------------------------------C-------
KRA44_HUMAN/70-114---------------Q..CC.QS-------------------------------------------------V-------
KRA44_HUMAN/115-159---------------R..CY.RP-------------------------------------------------H-------
KRA42_HUMAN/85-129---------------T..CC.RP-------------------------------------------------T-------
Q9D122_MOUSE/68-114---------------P..CC.SP-------------------------------------------------C-------
KR121_MOUSE/19-63---------------A..IC.IP-------------------------------------------------V-------

PF05287

KRA14_MOUSE/1-166FGC..........G..--.Y-PSQG.FGSHGFQSVGCGTPTFSSLNCGSS..FYRPTCF.........STKSC.QS....
KR261_HUMAN/4-210LRP..........LLN--SY-QPIGDCVPNAYRPQFCLSKSCQPQNLLTS..GCQPSSCLAYRPQSLHVVSSSLRPLGPL
KR134_HUMAN/1-155QGY..........GSR--CC-YSLG.NGSSGFRFLKYGGCGFPSLSYGSR..FCYPNYL.........ASGAW.QS....
Q9D6L6_MOUSE/1-179PSY..........LSD--GC-QPLG.YMTYGRPPWRNLTYGSQPF.......SCMPGCY.........GSTSY.NY....
Q3LI55_HUMAN/1-159LGG..........ISS--VC-QPVG.GISTVCQPVGGVST............VCQPACG.........VSRTY.QQ....
Q05B46_BOVIN/1-155LSG..........IST--VC-KPVR.SISTVCQPVGGVST............ICQPACG.........VSRTY.QQ....
KR241_HUMAN/6-191NGYVCNCHIPTRNASK--AC-QTLR.NGSNCFGQLNCLSKSFQTLN......HCRLSTL.........GYKSY.QN....
KR151_MOUSE/1-145FGF..........GSS--GI-RSQG.CGSN......................FYRPGYF.........SSKSI.QS....
KR261_MOUSE/4-213VSP..........FMN--NC-RPVS.CVSGGYRPLPCGSNSCRPLGIVTY..GCRPSGCVTYGPQTIHIVSNSLRPLQPV
Q6R646_CAPHI/1-162AG..............--QV-PSLG.FGSGGFQSVGHSPNIFSSLSCRSS..FYRPTFF.........SSRSG.RS....
Q9D6T8_MOUSE/1-200LAY..........GSR--SC-YPVG.CGSSGFRSLDCGVYGFPSLSYGSR..FYYPVYV.........ASTGF.QP....
KR132_HUMAN/1-170LGY..........GSR--SC-YSVG.CGSSGVRSLGYGSCGFPSLGYGSG..FCRPTYL.........ASRSC.QS....
KR271_HUMAN/1-201ASL..........KGN--SC-PPKT.SKSKNFETLERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESSPGV.EP....
Q8K198_MOUSE/1-165QGY..........GSR--SS-YSLN.CGSSGFRPQR.....VSSLGYGSG..FCHPSYV.........PYRTC.QS....
Q9D6S9_MOUSE/1-169QVY..........GSR--RV-YTSG.CGSSCFRPVSYRVCGYPSFGYGSR..FCHPTYV.........TSRNF.QS....

PF01500

KRA11_HUMAN/1-177----------------------
KRA3A_SHEEP/1-130----------------------
Q28707_RABIT/1-126----------------------
KRB2C_SHEEP/1-152----------------------
KRA13_HUMAN/1-177----------------------
O70148_RAT/1-188----------------------
KRB2A_SHEEP/1-172----------------------
KRB2D_SHEEP/1-182----------------------

PF13885

KRA45_HUMAN/25-69----------------------
KRA45_HUMAN/105-150----------------------
A6NC61_HUMAN/114-158----------------------
D3YXB6_MOUSE/83-125----------------------
KRA46_HUMAN/130-174----------------------
A0JN45_BOVIN/96-140----------------------
A0JN45_BOVIN/141-186----------------------
A2A4L9_MOUSE/69-113----------------------
A2A4M0_MOUSE/24-68----------------------
A2A4M2_MOUSE/84-127----------------------
A2A5X3_MOUSE/75-120----------------------
A2A5X3_MOUSE/232-274----------------------
KR10D_MOUSE/88-132----------------------
A4IF42_MOUSE/141-185----------------------
A6NFW2_HUMAN/170-213----------------------
KR108_BOVIN/111-155----------------------
A6QQG8_BOVIN/23-64----------------------
A6QQG8_BOVIN/120-162----------------------
A8MPS1_HUMAN/106-150----------------------
KR10D_HUMAN/68-112----------------------
KR10D_HUMAN/128-172----------------------
KR10D_HUMAN/193-237----------------------
KRA96_HUMAN/80-124----------------------
KR291_HUMAN/115-159----------------------
KR291_HUMAN/165-209----------------------
KRA91_HUMAN/37-79----------------------
KRA91_HUMAN/80-122----------------------
A8QW00_BOVIN/128-172----------------------
B1AQ90_MOUSE/24-68----------------------
B1AQ90_MOUSE/79-123----------------------
B1AQA8_MOUSE/109-152----------------------
B1AQA9_MOUSE/24-68----------------------
B1AQA9_MOUSE/178-222----------------------
B6CQV3_CAPHI/24-66----------------------
B9EIL2_HUMAN/41-85----------------------
D2HB39_AILME/26-71----------------------
D2HIQ1_AILME/153-197----------------------
D2HIQ2_AILME/193-237----------------------
D2HIQ2_AILME/253-297----------------------
D2HJK5_AILME/29-73----------------------
D2HR47_AILME/5-49----------------------
D2HR48_AILME/30-74----------------------
D3YXB3_MOUSE/75-119----------------------
D3Z5T3_MOUSE/78-123----------------------
D3ZD90_RAT/24-64----------------------
D3ZD90_RAT/103-146----------------------
D3ZDA4_RAT/130-174----------------------
D3ZDD4_RAT/137-184----------------------
D3ZDT9_RAT/84-128----------------------
D3ZDU4_RAT/27-71----------------------
D3ZEA5_RAT/163-207----------------------
D3ZGU7_RAT/27-65----------------------
D3ZJ72_RAT/72-115----------------------
D3ZKB5_RAT/71-114----------------------
D3ZMN9_RAT/29-73----------------------
D3ZMN9_RAT/133-177----------------------
D3ZMV5_RAT/79-121----------------------
D3ZNL6_RAT/173-218----------------------
D3ZNY7_RAT/180-226----------------------
D3ZRR1_RAT/101-148----------------------
D3ZTU8_RAT/141-185----------------------
D3ZUG4_RAT/130-173----------------------
D3ZV25_RAT/47-91----------------------
D3ZV25_RAT/107-151----------------------
D4A2F4_RAT/27-71----------------------
D4A2F4_RAT/73-117----------------------
D4A3Q1_RAT/42-85----------------------
D4A5R4_RAT/44-88----------------------
D4A8A6_RAT/73-116----------------------
D4A8P6_RAT/91-136----------------------
D4A8T7_RAT/139-184----------------------
KR121_HUMAN/24-68----------------------
KR101_HUMAN/71-113----------------------
KR103_HUMAN/84-128----------------------
KR105_HUMAN/60-102----------------------
KR105_HUMAN/199-244----------------------
KR106_HUMAN/265-311----------------------
KR104_HUMAN/349-395----------------------
Q08EG8_MOUSE/27-71----------------------
Q148I6_BOVIN/91-135----------------------
Q14C04_MOUSE/24-68----------------------
Q64526_MOUSE/118-164----------------------
Q6R637_CAPHI/14-56----------------------
Q6R637_CAPHI/57-98----------------------
Q8CAY5_MOUSE/64-107----------------------
KR412_HUMAN/110-154----------------------
KRA98_HUMAN/18-60----------------------
KRA98_HUMAN/65-109----------------------
KRA93_HUMAN/56-99----------------------
KRA92_HUMAN/32-75----------------------
KRA44_HUMAN/70-114----------------------
KRA44_HUMAN/115-159----------------------
KRA42_HUMAN/85-129----------------------
Q9D122_MOUSE/68-114----------------------
KR121_MOUSE/19-63----------------------

PF05287

KRA14_MOUSE/1-166...........VSYQPTCGTGF
KR261_HUMAN/4-210FSGCQPLTHVFSTCRPSC.SGL
KR134_HUMAN/1-155...........SCYRPICGSRF
Q9D6L6_MOUSE/1-179...........SSFQPYSSSLS
Q3LI55_HUMAN/1-159...........SC.....VSSC
Q05B46_BOVIN/1-155...........SC.....VSSC
KR241_HUMAN/6-191...........PCFIPSYVSPL
KR151_MOUSE/1-145...........SYYQPGYSSGF
KR261_MOUSE/4-213CGGCQPSIPVFGTCRPSCSAQG
Q6R646_CAPHI/1-162...........LSFQPTCGSGF
Q9D6T8_MOUSE/1-200...........SCYRSVCGTGF
KR132_HUMAN/1-170...........PCYRPAYGSTF
KR271_HUMAN/1-201...........TC....CVTGG
Q8K198_MOUSE/1-165...........PCYRPSCGTGS
Q9D6S9_MOUSE/1-169...........SCHRPTCGSTK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window