Sequence alignment for CL0523

PF14244

A5AE14_VITVI/10-125NDNPGNIITQ.VQL..KA-....---------------------------------.........LRAKKKYGFVDGSI.
A5AFL1_VITVI/24-172AEGSSFLITQ.HKL..TG-HNYH---------------------------------QWAKVVLMFITGXGKDEYLFSTT.
A5AL35_VITVI/26-142GDRPGDFITS.TRL..RG-DNYD---------------------------------DWASDIQLALEARRKFEFLEGTI.
A5APA9_VITVI/42-180TENSTAXIG..IKL..DG-STYA---------------------------------LWSQVVZMYIXGKDKLGYINDDCP
A5AR29_VITVI/23-171METSHLPITA.HKL..NG-QNYL---------------------------------QWSQSILMFIRGKEKDDYITGAS.
A5ARJ9_VITVI/24-165SENSIHHITV.HKL..NG-KNYL---------------------------------QWSQSVMMYICGRGKDNYITSAK.
A5ATA8_VITVI/24-171TDSAIAPIX..IKL..DG-TNYA---------------------------------LWSQVVEMYVAGKDKLGYINGDL.
A5AW26_VITVI/23-156LDKPTLNITI.EKL..NG-KFFL---------------------------------EWFHSVKLFLRSKMKMGYILGTI.
A5AXC5_VITVI/8-148SXQSIS.....VRL..DG-NNYS---------------------------------YWSYVMRNFLKGKXMXGYVSGVL.
A5AZ64_VITVI/47-175SDHPGLVLIS.KPL..NG-DNYS---------------------------------AWRKAMTLALNAKNKLGFVNGTI.
A5AZK9_VITVI/143-291LDNPTLQITT.EKL..NG-KKFL---------------------------------EWSHFEKLFLRIKKKMGYILGMI.
A5B0N9_VITVI/37-186KKNRFVNFNPKIIL..TE-SNYD---------------------------------VWSQLVELHIAEREKLSYIRGKT.
A5B3L9_VITVI/16-147FDNPSLSITI.HKI..NG-QNFL---------------------------------XWSQFVKLYIRGKGKIGYLTGST.
A5B8L2_VITVI/15-147IENSTAPIG..IKL..NG-SNYA---------------------------------LWSQVVEMYISDKEKLGYINDNC.
A5BAZ3_VITVI/31-163SDSSPILIIG.HKL..NG-HNYL---------------------------------QWSQSVLLFICGKGKDEYLIGEA.
A5BCQ9_VITVI/83-209SDHPGMVLVS.KVI..EG-DNYS---------------------------------TWSRAMRISLSAKDKIGFVTGSI.
A5BG06_VITVI/43-189TDSAIAPIV..IKL..DD-TNYA---------------------------------LWSQVVEMYVAGKDKLNYINDDL.
A5BJC0_VITVI/21-165QPGELQNIQAAYRL..DG-KNYL---------------------------------KWSQLVRTVLKGKGKIGHRMG...
A5BKK0_VITVI/191-331TDSPTV.LG..IKL..DG-SNYA---------------------------------LWSQVVEMYILGKDKPRYINGDL.
A5BM32_VITVI/27-149FDNPGALLVS.KIF..TG-ENYI---------------------------------AWSRSMSIALIVKNKIAFVDGSL.
A5BN45_VITVI/28-176AVNPSLLITG.HKL..NG-HNFL---------------------------------QWSQLVMMYVCGKGKDEYLTGEV.
A5BNR5_VITVI/308-456SDQPGHVLVP.IKL..NG-VNYQ---------------------------------SWSKAVIHALTTKKKIGFVDGTV.
A5BP26_VITVI/33-181LDHPGIVLVS.HHL..TG-ANYN---------------------------------TWSRAMVMALTAKNKISFIDGSI.
A5BQW4_VITVI/215-363SLNSNLQLMV.HKL..NK-KNYL---------------------------------ESAQFLKLAIERRGKLGHLTSEV.
A5BSG2_VITVI/5-152HETTSPTIS..IKL..DG-TNYS---------------------------------VWSQILDMHIVGXKKKGYITGTK.
A5BT41_VITVI/40-187SHEPTTQIG..IKL..DG-TNYA---------------------------------LWSQIVEMYISGKDKLGYINGDL.
A5BVQ3_VITVI/17-164ADSSTTXIG..IKL..EG-SNYA---------------------------------LWSQVVEMYISGKDKLGYINGDS.
A5BWZ5_VITVI/42-189ADSSTTPIG..IKL..EG-SNYA---------------------------------LWSQVVEMYISGKDKLGYINGDS.
A5BXA9_VITVI/396-529SDSSPILITG.HKL..NG-HNYL---------------------------------QWSQSVLLFICGKGKDEYLTGEA.
A5C3H8_VITVI/42-155TEYSIALIN..IKL..DG-SNYA---------------------------------LWSQVVEMYISGKDKMGYINGDC.
A5C4L4_VITVI/24-140SDHPGLVLIS.KSL..NG-DNYS---------------------------------AWKRAMILALNSKNKLGFVNGSI.
A5C4S3_VITVI/27-177GDHPSLSLVS.LSLAGSG-SNYH---------------------------------SWCRSMVTALNAKNKLGFIDGTI.
A5C9I0_VITVI/13-150GDHPGLIFVS.HNL..TG-SNYN---------------------------------TWSRVMAMALTMKNKIGFIDGTI.
B9SLN1_RICCO/35-176SDHTGMILFS.KTL..NG-DNYP---------------------------------GWKRAIKLALNLKNKLRFVEGSC.
O22175_ARATH/27-174SDNPGALISS.VVL..KE-NNYA---------------------------------EWSEELQNFLRAKQKLGFIDGSI.
O23588_ARATH/73-209SDHPGLNIVS.HIL..DG-TNYN---------------------------------NWSIAMRMSLDAKNKLSFVDGSL.
Q0PY40_SOLLC/17-166SDSSSAVLIP.IKLV.GS-EKYG---------------------------------IWSRAMRIALLGRRKYGFVTGAC.
Q2HT49_MEDTR/20-168SDGPSSLIIT.PKL..NG-SNYL---------------------------------AWHRSMQRALGAKNKLVFLDGSI.
Q2HU07_MEDTR/24-172SEGPNSVTVT.PLL..TG-PNYL---------------------------------AWNRSMKRALGTKNKFVFIDGSV.
Q6L4J8_SOLDE/13-160ADHTGICITP.VVL..KG-YNYE---------------------------------EWAKAMRNAFRAKKKLGFIDGLI.
Q9FIC5_ARATH/29-177GDNPGTLISK.PLL..RG-PNYD---------------------------------EWATNLRLALKARKKFGFADGTI.
Q9LGZ8_ARATH/19-166SDNPGALISS.VIL..KE-DNYS---------------------------------EWAEELMNSLQAKQKLGFLDGTI.
Q9M0P5_ARATH/20-169SDQAGLILVS.DRPS.SG-SEFH---------------------------------SWRRSVRMALNVRNKLGFIDGTI.
Q9XIM3_ARATH/23-161ADHPGLNIIS.HRL..DE-TNYG---------------------------------DWNVAMLISLDVKNKSGFIDGTL.
Q9ZPU4_ARATH/37-185SDNPGAVISS.VEL..NG-DNYN---------------------------------QWATEMLNALQAKRKTGFINGTI.

PF13961

Q5AT23_EMENI/319-345-------------L--DR.TNVS---------------------------------SWKVQYKLFLRTQG.---------
Q5AT23_EMENI/515-541-------------L--TK.TNVT---------------------------------TWKSDVREFCQIQG.---------
A0EVF5_MAIZE/104-132-------------F--DG.EDYG---------------------------------FWSHKMRSHLFSLHP---------
A0EVG6_MAIZE/136-164-------------F--NG.EDYA---------------------------------MWSNLMRFHLTSLHK---------
A0MEB8_ARATH/13-39-------------L--TK.SNYD---------------------------------NWSLRMKAILGAHD.---------
A2I5F8_BETVU/19-47-------------F--NG.KYYN---------------------------------YWKNRMEIFIKAENY---------
A2Q2M0_MEDTR/28-56-------------L--DG.SNYD---------------------------------YWKSRISAFLKSIDN---------
A2Q5V3_MEDTR/14-42-------------L--YE.TNYD---------------------------------YWKSRMSAYLKSVDS---------
A2XQ14_ORYSI/37-63-------------L--GE.NNYG---------------------------------VWAVKMKIFMRAQG.---------
A5ACV7_VITVI/14-40-------------F--NG.ENYQ---------------------------------VWAVKMKAYLRGLG.---------
A5ACV9_VITVI/13-39-------------L--DG.DNYE---------------------------------TWAVRMTVHLQALD.---------
A5ADA3_VITVI/15-41-------------F--DG.DNYQ---------------------------------AWAVRMTVHLEALD.---------
A5AE45_VITVI/21-49-------------F--IG.TDYP---------------------------------YWKPKMTWFLQSTDL---------
A5AFP3_VITVI/14-39-------------F--DG..HYD---------------------------------YWSMLMENFLRSKE.---------
A5AGS2_VITVI/15-41-------------F--DG.INYQ---------------------------------VWDVCMEAYLDASD.---------
A5AHH2_VITVI/133-159-------------V--EG.ECYE---------------------------------FWSIKMKTLFKSQD.---------
A5AHJ1_VITVI/21-49-------------F--TR.TDYP---------------------------------YWKTRMTWYLQSTDL---------
A5AKW8_VITVI/13-39-------------L--NN.QNYN---------------------------------TWSTCMMSYMQGQD.---------
A5AMT2_VITVI/33-58-------------F--DG..HYD---------------------------------HWSMLMEKFLKSKE.---------
A5ANP1_VITVI/21-49-------------F--TG.TDYP---------------------------------YWKMKMTWFFQSINL---------
A5ANX8_VITVI/14-40-------------F--AG.ENYR---------------------------------IWSVKMQMYLEAFD.---------
A5AVP1_VITVI/15-40-------------F--DG..YYD---------------------------------HWAMLMENFLRSKE.---------
A5AWN8_VITVI/13-39-------------F--NG.ENYQ---------------------------------TWAIRMTVHLQALD.---------
A5AX99_VITVI/16-44-------------L--TG.ENYS---------------------------------HWKVRMQYFLKMQSE---------
A5B0F2_VITVI/14-40-------------F--NG.EHYH---------------------------------IWAVKMRFYLRSQG.---------
A5B1X3_VITVI/15-41-------------F--DG.INYQ---------------------------------VWAIRMEANLDAND.---------
A5B3E3_VITVI/45-71-------------L--TE.SNYE---------------------------------NWSTCVKWYLVGQD.---------
A5B612_VITVI/21-49-------------F--TG.IDYP---------------------------------HWKTKMTWFLQSTNL---------
A5B8H9_VITVI/78-103-------------L--DA..HYD---------------------------------HWCMLMENFLRSKE.---------
A5BB46_VITVI/210-235-------------F--DG..HYD---------------------------------HWSMLMEKILRFKE.---------
A5BD08_VITVI/13-39-------------V--NG.DNYQ---------------------------------AWAIRMAVHLKALD.---------
A5BLB0_VITVI/214-240-------------F--NG.ENYD---------------------------------FWCVKMKTLFMSQD.---------
A5BLE1_VITVI/15-41-------------F--DG.DNYR---------------------------------FWAIRMKTHLDVMD.---------
A5BM96_VITVI/21-49-------------V--MG.IDYP---------------------------------CWKTKMTWYLQSTDL---------
A5BNN7_VITVI/10-36-------------F--TG.TNYS---------------------------------TWAFQFELFLKGKD.---------
A5BP60_VITVI/21-49-------------F--AG.TDYP---------------------------------YWKTKMTWLLQSTDL---------
A5BQA9_VITVI/73-99-------------L--TE.DNYE---------------------------------NWKACLQSYLIGQG.---------
A5BRW6_VITVI/14-40-------------F--VR.ENYQ---------------------------------IWYVKMQTYLKAFD.---------
A5BSL1_VITVI/14-39-------------F--DG..HYD---------------------------------HWSXLMXNFLRSKE.---------
A5BTH8_VITVI/21-49-------------F--TG.TBYP---------------------------------YWKTKMTWFIXSTSL---------
A5BV67_VITVI/23-49-------------F--NG.KNYL---------------------------------AWEFQYKMFMKGKE.---------
A5BVS1_VITVI/10-36-------------F--NG.SNFG---------------------------------LWKMKMKAILRKEN.---------
A5BXS1_VITVI/15-41-------------F--NG.DNYT---------------------------------IWAVRMEAYLDAVD.---------
A5C0Q9_VITVI/16-42-------------L--RE.GNYE---------------------------------NWRTCIKRYLVAQD.---------
A5C3F9_VITVI/15-41-------------L--MV.NTIH---------------------------------IWAVKMRFYLRSQG.---------
A5C3G4_VITVI/99-125-------------L--TE.GNYA---------------------------------YWRTCIRRYLKGQG.---------
A5C753_VITVI/21-49-------------F--MG.TNYP---------------------------------YWKTKMTWFLQSINL---------
A6FWP0_9RHOB/12-38-------------L--NN.QNYQ---------------------------------DWKFRMEMLMIREE.---------
A6YTD9_CUCME/15-41-------------F--SG.KNFN---------------------------------QWSIQMKVLYGSQE.---------
A9RSN5_PHYPA/14-40-------------F--DG.SWYS---------------------------------IWKKKIQMKFEMEN.---------
B0D6P6_LACBS/11-37-------------L--NN.SNYA---------------------------------EWSVRMEAILVRWG.---------
B0WQU4_CULQU/10-36-------------L--DG.TNWP---------------------------------VWEMRVEALLAVED.---------
B0WWB7_CULQU/11-37-------------L--NE.ANWS---------------------------------TWKLRMEALLDTEE.---------
B4K1A4_DROGR/12-38-------------L--DG.ENYV---------------------------------VWSVHMKSVLVHND.---------
B4LA17_DROMO/10-36-------------L--DE.GNYD---------------------------------TWRVQMRSVLVHQE.---------
B4LAF9_DROMO/10-36-------------L--DE.NNYG---------------------------------VWHMAMESVLEMAD.---------
B4LE08_DROVI/13-41-------------L--SGRDNYK---------------------------------EWSHKVELHMRIQE.---------
B4MX54_DROWI/10-37-------------L--RGRENYD---------------------------------VWKRQAQSYLVIKG.---------
B4NQE5_DROWI/11-37-------------L--NA.ENYD---------------------------------TWKLRMRAILVKND.---------
B4NQR9_DROWI/10-36-------------L--ED.SNYD---------------------------------WWCIQMKSVLVHAD.---------
B6HA76_PENCW/19-46-------------L--TGSDNFA---------------------------------TWKRLMTSYLKARQ.---------
B6QCF0_PENMQ/36-62-------------A--GR.SNIK---------------------------------NWKLRMQIFLETQD.---------
B6REL1_9BRAS/2-28-------------F--NA.TNYT---------------------------------VWAMRMKVGLRVHK.---------
B6REL9_9BRAS/23-49-------------L--NT.TNYT---------------------------------VWAMRMKIMLQIHK.---------
B6REM4_9BRAS/12-38-------------F--NG.ERYD---------------------------------FWRIKMTTILKTIK.---------
B6TPM7_MAIZE/33-59-------------L--SP.ASYT---------------------------------AWAIKVESILDAQG.---------
B6V6Z8_DROME/10-36-------------L--GD.DNYD---------------------------------VWSILMRSVLITAD.---------
B8BDZ6_ORYSI/26-52-------------L--TA.TNYT---------------------------------SWCIRVQAMMEDQG.---------
B9FWJ4_ORYSJ/161-187-------------F--DG.INYN---------------------------------HWAQHMHLNMRGQC.---------
B9GKP2_POPTR/14-40-------------L--SG.SNYN---------------------------------LWIQGMKSFLIGRK.---------
B9GSJ3_POPTR/134-160-------------F--EV.GNYE---------------------------------AWSKKMVDVLTSQH.---------
B9HE40_POPTR/16-42-------------F--NG.TNYD---------------------------------FWAVKMETVLIALD.---------
B9HFW3_POPTR/15-41-------------F--DG.ESYQ---------------------------------LWAVKMETYLEAFN.---------
B9HGE2_POPTR/14-40-------------F--TG.ENYH---------------------------------IWSVKMQAFLEAYD.---------
B9HKW4_POPTR/29-55-------------F--NG.ENYQ---------------------------------LWAVRMETYLEAMD.---------
B9HL08_POPTR/16-42-------------L--RG.DNYD---------------------------------DWSACMKSYMLAQD.---------
B9HPY3_POPTR/20-46-------------F--DG.YHYE---------------------------------YWSSQMETIFISQD.---------
B9I2Y2_POPTR/15-41-------------F--NS.DNYE---------------------------------TWTIRITVLLEALD.---------
B9I573_POPTR/13-39-------------F--TG.QNFG---------------------------------VWTVKMETYLKAFD.---------
B9IBK8_POPTR/14-40-------------F--TG.GNYQ---------------------------------MQVVRMKTYLQACD.---------
B9IK76_POPTR/27-53-------------F--NV.ENYR---------------------------------FWIVKMETYQEALD.---------
B9MXT9_POPTR/15-41-------------F--NG.ENYE---------------------------------TWAIKMTIHLEALD.---------
B9NB79_POPTR/15-41-------------F--NG.DNYQ---------------------------------TWAVRMKTYLDVLD.---------
B9NCJ4_POPTR/14-40-------------F--TG.ENYQ---------------------------------MWAARMKTYLQGCD.---------
B9NDW0_POPTR/15-41-------------L--IE.SNYK---------------------------------VWRTCLESYLIGED.---------
B9NL03_POPTR/15-41-------------F--DG.TNYQ---------------------------------VWAVRMEAYLDAND.---------
B9P6D1_POPTR/13-39-------------L--IK.DNYK---------------------------------TWCIRIKAWLGFQD.---------
B9P7V6_POPTR/11-37-------------F--DG.INYQ---------------------------------VWAVRMEVYLNAND.---------
B9PAL4_POPTR/13-39-------------L--TK.DNYD---------------------------------SWCIRLKAFLGSQE.---------
B9PCS7_POPTR/28-54-------------L--SE.TNYG---------------------------------IWAVKMKIILRSLG.---------
B9RBX9_RICCO/17-43-------------L--TG.DNYS---------------------------------KWAVKMQCYLQAFD.---------
B9RC68_RICCO/10-37-------------L--GSYNNYA---------------------------------NWSACMKSYLLAND.---------
B9S5P6_RICCO/16-42-------------L--DS.DHYN---------------------------------IWHLKMHYVLKEQE.---------
C0JJI1_SOYBN/14-40-------------L--TK.ENYD---------------------------------NWCRRMKALLGSQD.---------
C1IJC5_HORVU/51-77-------------L--TR.TNYA---------------------------------EWSLLMEVGMQARG.---------
C5GBD9_AJEDR/188-215-------------L--TGTSNYT---------------------------------TWSISMKLKLVDAQ.---------
C5WNA6_SORBI/166-192-------------L--TR.TNYG---------------------------------EWAVTMKVKLRARR.---------
C5XQM0_SORBI/42-68-------------L--TK.SNYH---------------------------------EWSTLMRLKMQARQ.---------
C5XUK3_SORBI/137-163-------------L--DK.SNYY---------------------------------EWSQTMKLRMQARD.---------
C5Z583_SORBI/42-68-------------L--TR.TNYG---------------------------------EWATQMKWKLRARK.---------
C6JSM1_SORBI/23-49-------------L--TA.NNYI---------------------------------SWSIRVRAIMEDQG.---------
C7J1L6_ORYSJ/181-207-------------L--TK.TNYI---------------------------------EWAAVMRVRLQVWH.---------
C7J1U3_ORYSJ/16-44-------------F--DG.TNYA---------------------------------QWKIHMISYFTAMSP---------
C7J5A1_ORYSJ/49-75-------------L--TK.TNYN---------------------------------DWALLMKIKLQAHC.---------
C7J6P4_ORYSJ/14-42-------------F--DG.TDFP---------------------------------HWCCKMQSYIMAENY---------
C7J7K5_ORYSJ/83-109-------------L--TR.TNYT---------------------------------DWALVMRVNLQAQG.---------
D0NBZ2_PHYIT/18-44-------------F--DG.ADFE---------------------------------MWLERVKLKLQRKH.---------
D0P386_PHYIT/3-29-------------F--NG.KNYA---------------------------------PWKARIKTLLQAKR.---------
D0P4P1_PHYIT/16-42-------------F--DG.TGYR---------------------------------VWARQLQLYLEVKD.---------
D0RLQ9_PHYIT/21-47-------------F--DG.KDYE---------------------------------VWHERVKLKMQRKK.---------
D2A4C7_TRICA/13-39-------------L--NK.ENYD---------------------------------TWKIQMQAVLIKCD.---------
D2A543_TRICA/14-40-------------F--NG.KDYD---------------------------------HWKFRMEIILDHHD.---------
D3IVE4_9POAL/157-183-------------L--TT.DNYL---------------------------------VWAMKMKANMRAQG.---------
D3IVI1_9POAL/13-41-------------F--DG.IDYP---------------------------------FWKSRMETYIQAQGY---------
Q01L11_ORYSA/14-42-------------F--NG.TNYS---------------------------------TWKIKMSTHLKAMSF---------
Q01L55_ORYSA/55-83-------------F--DG.THYA---------------------------------AWKHKMKLHLIFLHP---------
Q01LI0_ORYSA/9-35-------------F--AG.ENYD---------------------------------IWSIKMRTLLLSQG.---------
Q01MW9_ORYSA/19-45-------------L--TK.TNYG---------------------------------DWALMMKVMLQARS.---------
Q0DA14_ORYSJ/28-54-------------L--TR.ANYH---------------------------------QWALVMRVSLEALE.---------
Q0IZT5_ORYSJ/33-59-------------L--TS.TNYS---------------------------------TWAIKMEANMEAQG.---------
Q0J5Y3_ORYSJ/54-80-------------L--TR.TNYD---------------------------------EWAMLMQVNMEAAG.---------
Q0WNA8_ARATH/12-38-------------S--DD.LNYE---------------------------------IWAPIAKTTLTEKG.---------
Q10B81_ORYSJ/39-67-------------F--NG.TDYA---------------------------------AWKHKMKMHLKSINS---------
Q10F54_ORYSJ/861-887-------------L--TK.TNYA---------------------------------EWAMVMKVKLQARH.---------
Q10PG0_ORYSJ/12-40-------------F--DG.HNFV---------------------------------IWKARMEAYLQSQGH---------
Q16S15_AEDAE/12-38-------------F--DG.TNFS---------------------------------NWSFRMESYLEELG.---------
Q25AF6_ORYSA/59-85-------------L--TR.TNYT---------------------------------EWSLLMKVMLQARG.---------
Q2QS45_ORYSJ/14-42-------------F--DG.MDFS---------------------------------HWCSRMQSYIMAEDY---------
Q2R0F7_ORYSJ/478-504-------------L--TK.TNYN---------------------------------EWSLLMKIKLQARF.---------
Q4ABY7_BRACM/25-51-------------L--NS.SNYT---------------------------------VWAMRMKVALKVNK.---------
Q6K285_ORYSJ/82-108-------------L--TK.TNYS---------------------------------NWELLMKVKLKTRA.---------
Q6L3N8_SOLDE/17-43-------------F--RG.ENYQ---------------------------------FWSLKMKTLFKSQE.---------
Q6XMP8_AEDAL/16-42-------------F--AG.RGYD---------------------------------VWQFRVQTYLESAN.---------
Q710T7_POPDE/16-42-------------L--DG.KNYS---------------------------------YWSYVMRNFLKGKK.---------
Q75M81_ORYSJ/48-74-------------L--TR.SNYS---------------------------------DWAVLMRVNLQAQG.---------
Q7G5Z8_ORYSJ/52-78-------------L--TS.SNYI---------------------------------EWSLLMKVNMQAQG.---------
Q7G756_ORYSJ/12-40-------------F--DG.TDFP---------------------------------YWCSKMQSYIMAKDL---------
Q7XH44_ORYSJ/104-130-------------L--TR.TNYE---------------------------------ECALFMTVNQQAQG.---------
Q7XKY1_ORYSJ/53-79-------------L--TK.TNYS---------------------------------DWSLLMRAMLQVRG.---------
Q7XMT1_ORYSJ/56-82-------------L--SR.TNYP---------------------------------DWALLMRVNLQEQG.---------
Q84Q85_ORYSJ/36-62-------------L--TR.TNYH---------------------------------EWSLVMQVSMEALE.---------
Q84VH6_SOYBN/16-44-------------L--DG.TNYE---------------------------------YWKARMVAFLKSLDS---------
Q850T3_ORYSJ/12-40-------------F--DE.TGFS---------------------------------YWCSKMQSYIQAEDY---------
Q8H6I0_MAIZE/134-162-------------F--DG.EDYA---------------------------------RWSDLMRFHLISLHK---------
Q8H6I4_MAIZE/130-158-------------L--SE.LNYD---------------------------------EWADKMKSHLIGVHP---------
Q8H6W2_CICAR/19-47-------------F--NG.TAYM---------------------------------YWKQRMLIFLEASGI---------
Q967L5_AEDAE/11-37-------------L--NG.TNWA---------------------------------TWKLRVENLLARDD.---------
Q9C7Y1_ARATH/12-37-------------F--DG..DYE---------------------------------HWAMLMENLIRSKE.---------
Q9LE43_ARATH/25-51-------------L--NT.TNYT---------------------------------VWAMKMKVALKVHK.---------
Q9LH44_ARATH/12-38-------------F--NG.ESYG---------------------------------FWKIKMITILKTRK.---------
Q9LIG4_ARATH/14-40-------------S--DD.LNYE---------------------------------IWAHIMKTSLVEKG.---------
Q9LJ55_ARATH/26-52-------------L--SA.TNYN---------------------------------VWTMRMRLLLKVHK.---------
Q9LJD1_ARATH/12-38-------------S--DQ.FDYE---------------------------------IWAPITKSTLIEQG.---------
Q9LJD2_ARATH/12-38-------------S--DD.FDYE---------------------------------IWSSVTKATLTEKE.---------
Q9LNQ5_ARATH/22-48-------------L--NS.NNYT---------------------------------VWAIRMQITLGIYK.---------
Q9M1C6_ARATH/15-40-------------F--DG..YYD---------------------------------FWSMTMENFLRSRE.---------
Q9MAR7_ARATH/25-51-------------L--NA.INYT---------------------------------VWAMRMKRALKVHK.---------
Q9SKV6_ARATH/22-48-------------L--TS.TNYT---------------------------------VWAIRMQIARSVNK.---------
Q9XEB1_ARATH/10-36-------------F--NK.ENYG---------------------------------FWRIKMKTIFQTKK.---------
Q9XEB1_ARATH/348-376-------------L--DA.EHYG---------------------------------YWKVLIKRSIQSIDM---------
Q9ZQE9_ARATH/12-38-------------F--DG.EKYD---------------------------------FWSIKMATIFRTRK.---------
Q9ZTG6_TOBAC/19-47-------------F--DG.SNYA---------------------------------YWKERMRVFIRANNF---------

PF14223

Q0KIL6_SOLDE/91-204-------------L-----SAFE---------------------------------FLENLKQMFGDQG..Q...SAKQI
A5BQ76_VITVI/412-525-------------D-----TAYD---------------------------------ILENLKEMFGDQT..S...AARQN
A5AHT8_VITVI/92-205-------------T-----RAKA---------------------------------FLDQIANRFAANK..K...VETST
B8BH64_ORYSI/219-332-------------T-----TAKV---------------------------------FLETLQKRFARNE..K...AETST
A5BI38_VITVI/288-401-------------D-----NVKA---------------------------------LLKVIDEQFVTLD..K...ALANT
B9GJ95_POPTR/37-150-------------R-----SIQA---------------------------------AWDAIKIQYGETS..T...TRLCQ
A5ANU6_VITVI/96-209-------------N-----SARE---------------------------------IWEALENKYKAEE..E...GTKKF
A5B8Q0_VITVI/530-643-------------N-----MATK---------------------------------LWLKLESLYMTKS..L...TNRLY
A5AQ94_VITVI/79-192-------------T-----TAKG---------------------------------VWNKLEQLYMQNS..L...SNRLY
Q18L98_CITSI/81-195-------------K-----TALG---------------------------------IWNKVETLCMKKS..L...AHRLF
Q1KUM3_9ROSI/118-231-------------R-----TAFG---------------------------------IWRKLERLHIEQS..L...PNRMY
Q7XTM9_ORYSJ/78-191-------------E-----TAAG---------------------------------LWLKLEQICMTKD..L...TSKMH
Q01M93_ORYSA/78-191-------------K-----TSAE---------------------------------LWLKLESICMSKD..L...TSKMQ
A5AS33_VITVI/79-194-------------K-----TIAD---------------------------------LMKALSGMYEKPS..A...NYKVH
Q2AA06_ASPOF/860-974-------------T-----SVMK---------------------------------MWEILNNKYLTKS..V...ENRLH
Q6XMP8_AEDAL/82-196-------------G-----TAKA---------------------------------MWKSLEDTFAKKS..A...GRQTL
D2A543_TRICA/77-191-------------T-----TAYQ---------------------------------MWISLEAGFQRKG..I...TSQLF
Q9U6V8_DROWI/75-189-------------I-----TARQ---------------------------------ILENLDAVYERKS..L...ASQLA
A5BIJ4_VITVI/84-197-------------N-----PAYK---------------------------------LWMRQDNLLSLTI..IG..SQILN
Q0ZCD8_POPTR/118-230-------------K-----TSQE---------------------------------AWHKLHTMYASKS..R...SRALQ
A5B6L3_VITVI/126-238-------------S-----SAFE---------------------------------VWNTISHNFNSQS..S...AKVMF
A5BYA6_VITVI/62-174-------------D-----TSFL---------------------------------FWGRLEQYFASQT..R...AKVKQ
A5BK17_VITVI/103-215-------------D-----TSAQ---------------------------------VWKTLELYFATQV..R...AKVTQ
A5CAE5_VITVI/64-176-------------Q-----TSHE---------------------------------AWTALQQSFSAST..K...ARTMQ
A5BJ70_VITVI/81-193-------------Q-----TSHE---------------------------------AWMALHKIFSASS..K...ARIMQ
A5BFR8_VITVI/115-227-------------N-----TSHS---------------------------------AWNALESIFSSSS..R...ARIMQ
Q9SV56_ARATH/103-217-------------H-----TSRE---------------------------------VWFSLAKKYNRVS..A...SRKSD
Q9SSB1_ARATH/101-216-------------F-----TSHQ---------------------------------VWLTLANHFNRVS..S...SRLFE
D1GEF6_BRARP/107-222-------------T-----NSYE---------------------------------IWMTLASHFNRPT..S...ARLFE
C0SQ79_PORYE/115-228-------------K-----TAAE---------------------------------VWECLRVLFDHET..A...TRRGE
A5B3I2_VITVI/89-207-------------D-----TAKN---------------------------------IWDSLKQKYQGTT..RVKRAHLQA
A5B8H9_VITVI/153-271-------------D-----TAKC---------------------------------IWDSLKQKYQGTA..RVQRAQRQA
A5BGM4_VITVI/89-207-------------D-----TSQQ---------------------------------IWDSMKKKYQGSM..RTKRQQLQA
Q9M1C6_ARATH/91-209-------------S-----TSKA---------------------------------IWESMKKKYQGST..KVKRAQLQA
A5BYF7_VITVI/162-280-------------N-----TSKS---------------------------------IWDSIRQKYQGST..RVKQAQLQA
A5BY31_VITVI/28-146-------------N-----TSKQ---------------------------------IWDSMKKKYEGNA..RVKRSILQA
A5BFQ9_VITVI/28-146-------------D-----TAKD---------------------------------IWDAMKKKFEGNA..RVKRSHLQA
Q9C7Y1_ARATH/87-205-------------E-----TSKD---------------------------------LWESMKRKYQGND..RVQSAQLQR
A5AMT2_VITVI/80-198-------------D-----TAKH---------------------------------IWDSMKKKYXGTT..RAKRQQLQA
Q2QXM6_ORYSJ/85-203-------------K-----KSKK---------------------------------AWDKLKEEFQGSQ..KVLAVKLQT
Q6L3N8_SOLDE/84-202-------------E-----TSKQ---------------------------------AWEILKQEYFGDD..KVITVKLQT
A6YTD9_CUCME/91-209-------------T-----SAKA---------------------------------AWDILRSTYQGED..KVKMIRLQA
Q9M2D1_ARATH/89-207-------------T-----SAKE---------------------------------AWEKLRTSYKGAD..QVKKVRLQT
B9IN28_POPTR/105-223-------------K-----TAKG---------------------------------AWDILSREFRGDK..KVRAVKLQA
A5BLB0_VITVI/283-400-------------S-----KAKE---------------------------------AWDILQQEFQGDK..RTRSVKLQA
Q9LH44_ARATH/87-205-------------S-----SATE---------------------------------AWNALEMEFQGSS..QVKMINLQT
Q9ZQE9_ARATH/91-209-------------S-----SSKE---------------------------------AWDVLKDEYQGSP..QVRLVKLQS
A5B9M8_VITVI/90-208-------------E-----TPKQ---------------------------------VWDKLQGEFEGSE..RVKNVRLLT
A5BRD1_VITVI/91-209-------------K-----TTNE---------------------------------IWNFLKKEYEGNE..QVKGMQVLN
A5B779_VITVI/91-209-------------E-----SAKD---------------------------------IWDHLKKEYQGNE..RTKNMQVLN
Q9SEL2_VITVI/89-207-------------D-----SAAE---------------------------------IWEYLKEEYKGDE..RIKNMQVMN
A5BFD6_VITVI/89-207-------------E-----SATE---------------------------------IWKHLWEEYQGNE..RLRNMQVMN
B9N6H7_POPTR/91-209-------------K-----SAKD---------------------------------VWDYLKKEYVGDE..KIRGMQNLN
B9HFW3_POPTR/91-209-------------K-----LAKD---------------------------------VWDYLKKEYAGDE..RIRGMQSLN
B9P8C1_POPTR/91-209-------------K-----TAKE---------------------------------IWEFLKTEYEGDE..RIQGMQVLN
A5BRW6_VITVI/90-208-------------R-----TTKE---------------------------------AWDKLKLEYQGSD..RTKQMQVLN
Q6L3X6_SOLDE/202-320-------------K-----TAKE---------------------------------AWDRLKEEYQGSD..RTRQMQVLN
A5ACV7_VITVI/90-208-------------E-----TPKE---------------------------------AWDKLKEMYLGSD..RTRQMQILN
Q6L3Y5_SOLDE/89-207-------------E-----SAKE---------------------------------SWDMLKQEFQGSD..RTRQMQILN
Q60EG1_ORYSJ/85-201-------------R-----TAKE---------------------------------VWDCLKTRFVRAD..RVRDARLQT
C6JSM1_SORBI/92-210-------------K-----TGKE---------------------------------VWDALKARHVGAD..RVKEARLQT
B6TPM7_MAIZE/94-212-------------K-----TAAE---------------------------------VWASLKTRFVGAD..RVKTARLAT
Q9SHT5_ARATH/47-166-------------K-----TSKA---------------------------------MWEAIKTRNLGAE..RVKEAKLQT
Q9ZUF2_ARATH/41-160-------------K-----TSKA---------------------------------VWDKIQSRNLGAE..RVKEAKLKT
Q4ABY7_BRACM/83-202-------------E-----DAKA---------------------------------VWDAIKTRHVGAE..RVREARLQT
Q9LQK3_ARATH/80-199-------------Q-----TAKE---------------------------------VWDSIKTRNVGAE..RVKEARLQT
Q9SKV6_ARATH/80-199-------------A-----TAKL---------------------------------VWDSIKTRYVGAD..RVKEARLQT
Q9LE43_ARATH/83-202-------------D-----TAKK---------------------------------VWEAIKEKNVGAE..RVKEARLQT
B6REL9_9BRAS/81-200-------------D-----SSKA---------------------------------IWEAIKTRHLGAE..RVKEARLQT
B6REL1_9BRAS/60-179-------------D-----TTKG---------------------------------IWEAIKTRHMGAD..HVREARLQT
B9PCS7_POPTR/86-204-------------Q-----TAKE---------------------------------AWDALREMRIGED..RVKKARVQV
Q7F814_ORYSJ/95-213-------------E-----TAKE---------------------------------AWDALKQMNMGEE..RVKKARVQT
B8BA29_ORYSI/100-218-------------E-----TASD---------------------------------VWVALRYMHVGGE..RVRVARIQS
D3IVE4_9POAL/219-337-------------E-----TARE---------------------------------VWVTLQKMHEGVD..RVKEVRLQN
Q7X7K3_ORYSJ/176-294-------------E-----TVQE---------------------------------AWEAIKTRRIGVQ..HVREANAQQ
Q0J5Y3_ORYSJ/115-233-------------R-----SARA---------------------------------AWDAIKTIRVGVE..RVRESKAQQ
Q7XH44_ORYSJ/165-269-------------R-----TVKS---------------------------------AWEAIKTVCVGTR..RVREANEQL
Q2QYR6_ORYSJ/52-170-------------N-----YTEW---------------------------------SMEAIRTIRVGVE..RVKEANAQK
Q5TKD7_ORYSJ/109-227-------------D-----TAKE---------------------------------VWDAIKTMRVGVD..RVREAREQA
Q7XTU6_ORYSJ/114-232-------------D-----TAKA---------------------------------AWDAIKTMRVGVD..RVREAKEQG
Q8LMZ0_ORYSJ/135-253-------------D-----TAKE---------------------------------AWESVKTMRVGVA..RVREAKAQT
Q7G5Z8_ORYSJ/110-228-------------D-----TAKE---------------------------------AWEAVRTMRMGVE..RVREAKAQS
Q53P77_ORYSJ/86-204-------------E-----TAKA---------------------------------AWDCIKTMRVVND..RIRKASAQK
Q2QZL2_ORYSJ/49-167-------------A-----SARE---------------------------------AWECIKTMRVGND..RIRKASAQK
Q7XWP2_ORYSJ/116-231-------------A-----SAKE---------------------------------AWDCIKTMRVGDN..RIRKASAQR
Q10C26_ORYSJ/22-139-------------E-----TAKE---------------------------------AWDSIRVMRVGVD..RVRKSKAQL
Q7XUD9_ORYSJ/115-233-------------P-----SAKE---------------------------------AWDAIKTMRVGVD..RVRKSKAQM
Q25AF6_ORYSA/117-235-------------D-----SAKD---------------------------------AWDAIKVMHVGVD..RVRKAKAQQ
C1IJC5_HORVU/114-232-------------K-----TSQE---------------------------------LWEAIRAMRAGSA..RVRDAKAQN
C5Y7F6_SORBI/35-153-------------K-----SFKE---------------------------------AWEAIKTMRLGAD..RVKEVDAQK
Q94I41_ORYSJ/94-212-------------K-----SAKE---------------------------------AWDVVKKMHAGDD..RVKATSVQR
C5XUK3_SORBI/218-337-------------A-----TAKE---------------------------------AWDAIAATRIGVD..RVRRATLQR
C5XQM0_SORBI/100-219-------------L-----TAKE---------------------------------VWNSIAAARIGID..RVRRATLQR
Q9AUM6_ORYSJ/569-688-------------R-----TTKD---------------------------------AWDAIASARIGSD..RARRSTLQK
Q2QWI2_ORYSJ/47-166-------------R-----TAKE---------------------------------AWDAIAAARIGSD..RARKSTLQA
C5Z583_SORBI/100-218-------------D-----TAKQ---------------------------------AWEMLESLRIGSD..RAKRARIQQ
C5WNA6_SORBI/224-342-------------K-----TAKE---------------------------------AWEAIAAMRVGSD..RAKKATAQL
D3IVP8_9POAL/630-749-------------K-----SANK---------------------------------IWTTLADYHEGSK..SVKGVHQNQ
D3IVT7_9POAL/58-177-------------R-----SAHE---------------------------------IWKTICDYHEGST..AIKEVRQNQ
D3IVI1_9POAL/86-205-------------S-----SAYD---------------------------------IWVTLDAYHEGTT..QIKTVRQDQ
Q10PG0_ORYSJ/85-204-------------K-----SAHD---------------------------------MWTALCNFHEGNN..DIQLVRQNQ
D3IVI3_9POAL/99-218-------------E-----TAHE---------------------------------IWHTLETYHEGSS..QIKQVRQTV
Q5H9X1_ORYSJ/112-231-------------E-----SAKV---------------------------------IWDTLRNLHEGTD..SVRESKVEI
Q10NE5_ORYSJ/129-248-------------E-----EAKE---------------------------------IWDTLQLAHEGSP..AVREAKIEL
C5WYF6_SORBI/63-181-------------N-----VAKQ---------------------------------IWDTLVLAHEGVD..KVRKAKIDL
Q8S467_MAIZE/138-257-------------K-----NAKE---------------------------------IWDLLKTAHEGDE..LTKITKRET
Q8H6I4_MAIZE/204-323-------------E-----DARD---------------------------------IWNILRMSHEGDP..KAKRHRVEA
Q33BC8_ORYSJ/86-203-------------E-----TAYE---------------------------------IWNKLAEIHEGTS..EYKDAKLHF
A2Q5V3_MEDTR/101-218-------------D-----VAKD---------------------------------AWDILRTTHEGTS..KVKSSRIQL
O65147_SOYBN/76-194-------------T-----VAKD---------------------------------AWEILKTTHEGTS..KVKMSRLQL
A5BZ48_VITVI/103-221-------------T-----SAKE---------------------------------AWDILQVTHEDTN..AVKVSKLLM
Q9XEB1_ARATH/433-551-------------L-----SAKE---------------------------------VWEILQVSFECTN..NVKRTRLDM
Q9FG84_ARATH/101-219-------------E-----SAKE---------------------------------AWDKLAKAYEGTS..SVKRSRIDM
Q9ZV83_ARATH/82-200-------------K-----SAKQ---------------------------------AWDTLQKSHEGTS..SVKRTRLDH
A2I5F8_BETVU/104-223-------------K-----SAKQ---------------------------------IWDLLEVTHEGTN..EVKRSKIDL
A5BW11_VITVI/73-191-------------K-----SAKE---------------------------------IWRLLEITHEGTN..QVKESKINL
Q1S5J6_MEDTR/118-236-------------S-----TAKA---------------------------------MFASLCANFEGSK..KVKEAKALM
Q9FJT0_ARATH/33-146-------------T-----SSKE---------------------------------AWEILMVRSVGGP..IFQARKLLD
Q9LJD1_ARATH/93-210-------------S-----SAKD---------------------------------VWDLLRKGNEQATIRRLEQVTIRR
Q9LJD1_ARATH/509-622-------------S-----SAKD---------------------------------LWDSLEKGNNEQ.......AKLRR
Q9LJC8_ARATH/91-202-------------A-----SAKE---------------------------------LWDLLKK...GND..T.KEAKLRR
Q9LJC9_ARATH/91-203-------------A-----SSKE---------------------------------LWDLLKK...GND..NEEAKKLRR
A9TSN8_PHYPA/23-136-------------T-----NLAV---------------------------------AWKILANVYSTQT..M...ADVMK

PF14227

A5BY76_VITVI/104-226------------CK-----LAKE---------------------------------IWRLLEITHEGTN--QVKESKINL
A5B9Z7_VITVI/12-134------------CK-----XAKE---------------------------------IXRLLEITHEGTN--QXKESKINI
A5BSC1_VITVI/688-789------------YQ-----STQC---------------------------------TFIGYSLSHKGYL--CVSPRV...
A5BWL8_VITVI/342-448------------CY-----MIRV---------------------------------FAFQVD.......--.........
A5BLR1_VITVI/94-215------------WK-----AFRL---------------------------------VWNTIIDVLMTXN--DVMVGITXA
A5BLB0_VITVI/282-404------------AS-----KAKE---------------------------------AWDILQQEFQGDK--RTRSVKLQA
Q9LJC9_ARATH/90-212------------VA-----SSKE---------------------------------LWDLLKKGNDNEE--AKKLRRL..
Q5AT23_EMENI/392-511------------LE-----TSGD---------------------------------MWAFLMKKYERRT--QVDVTNA..
D3IVP8_9POAL/629-752------------IK-----SANK---------------------------------IWTTLADYHEGSK--SVKGVHQNQ
COPIA_DROME/74-192------------DI-----TARQ---------------------------------ILENLDAVYERKS--LASQLAL..
D2A543_TRICA/76-194------------KT-----TAYQ---------------------------------MWISLEAGFQRKG--ITSQLFL..
O96968_BOMMO/78-193------------AT-----SAKE---------------------------------MIENLRKIFKRKS--TLSALYV..
Q6XMP8_AEDAL/81-199------------KG-----TAKA---------------------------------MWKSLEDTFAKKS--AGRQTLI..
B0X5G3_CULQU/101-222------------KK-----TAKE---------------------------------MWDTLLGIHEVES--MNTMMTV..
Q967L5_AEDAE/76-197------------CV-----NAHD---------------------------------VFGALKAYHEKST--RSVRVSL..
Q8WRX6_ANOGA/74-195------------CK-----TAKG---------------------------------TWDALQKHHQKTT--MSTKVSL..
B2CN78_DAPPU/42-160------------CR-----TAYE---------------------------------MWTRLSAQHLRNA--VENQHVL..
A9RF54_PHYPA/34-146------------KR-----QEKK---------------------------------AFGIIATNIDESN--F........
Q8H023_ORYSJ/210-330------------EK-----TPKE---------------------------------IWDKLASLYMSKS--LTSKLYL..
Q7XSZ1_ORYSJ/103-219------------EN-----RSNT---------------------------------DFEADAD...SKP--MTTSGFP..
Q7XLX2_ORYSJ/160-253------------ET-----SPKI---------------------------------IWEKLEAQFMSKT--LTNKRYL..
A5BPQ9_VITVI/512-624------------VD-----YSLN---------------------------------QGAPAGHESADTP--SGHESMV..
A5B864_VITVI/32-156------------EE-----SPTT---------------------------------NWLKLESRYMSKL--LRNKLYL..
Q9AU17_SOLCI/79-196------------EE-----SACG---------------------------------IWTKLENLYMSKT--LTNKLYL..
B1N668_SOLLC/75-192------------EE-----TAAG---------------------------------LWLKLESLYMTKS--LTNKLLL..
Q2AA06_ASPOF/859-977------------VT-----SVMK---------------------------------MWEILNNKYLTKS--VENRLHL..
B9NAJ4_POPTR/37-154------------QN-----SAKE---------------------------------LWQALEDKFMKKS--IENRLYL..
Q69FA7_PHAVU/58-175------------ET-----SAHK---------------------------------LWKALEDKFLKKS--GQNKLLM..
Q6BCY1_IPOBA/74-193------------KK-----TANE---------------------------------IWDHLNRLYEAKS--LHNKIFL..
B8YLY5_MEDTR/73-192------------KK-----TAKE---------------------------------IWDTLIKLYEVKS--LHNRIFL..
Q25A78_ORYSA/77-175------------EE-----TAAG---------------------------------LWLKLEQICMTKD--LT.......
Q53QA4_ORYSJ/75-188------------EK-----TSAE---------------------------------LWLKLESICMSKD--LTSKMQM..
Q94LG0_ORYSJ/79-192------------EK-----TAAE---------------------------------LWLKLESICMSKD--LTSKMHI..
Q01MJ3_ORYSA/27-111------------EE-----TAAG---------------------------------LWLKLEQICMSKD--LTSKMHL..
A5BQQ6_VITVI/23-136------------EK-----TVVA---------------------------------LWLKLEQLWMTKS--LTSKLHL..
A5BPL2_VITVI/25-141------------EK-----TVXA---------------------------------LWLKLEQLCIXKS--LTXKLHL..
Q9SJT2_ARATH/93-212------------EQ-----SAAA---------------------------------MLGVLDKLYMSKA--LPNRIYQ..
Q9SH77_ARATH/93-212------------ES-----TAAA---------------------------------MLLALDKLYMSKA--LPNRIYP..
Q9FFM0_ARATH/98-215------------QK-----TAAG---------------------------------MIKVLDQLFMAKS--LPNRIYL..
Q9LS18_ARATH/107-224------------EE-----TAAG---------------------------------MISVLDKLYLSDP--LSSRISL..
Q9ZQE4_ARATH/102-211------------CE-----TAAA---------------------------------MWSTLKRLYMETS--LPNRIYL..
Q9LJS6_ARATH/105-202------------CE-----TVAA---------------------------------MWSTLNKLYMETS--LPNRIYL..
O81903_ARATH/103-220------------CV-----TAAE---------------------------------LWATLNKLFMETS--LPNRIYT..
Q9SHR5_ARATH/101-218------------YA-----TTAD---------------------------------LWATLNKKYMETS--LPNRIYT..
Q9LVY5_ARATH/105-222------------CK-----TAAT---------------------------------LWELLNELYMETL--LPNRIYA..
Q02900_ARATH/97-214------------CK-----SAAE---------------------------------MWKTLNKQYMETS--LPNRIYV..
O82196_ARATH/63-180------------SK-----TAAE---------------------------------AWATLDKLYLVKS--LPNRVYL..
Q9ZPU5_ARATH/68-187------------CK-----TAAE---------------------------------AWETLDRLFMIRS--LPHRVYT..
Q1KUM3_9ROSI/117-234------------ER-----TAFG---------------------------------IWRKLERLHIEQS--LPNRMYL..
A5AR03_VITVI/133-256------------SS-----LCQA---------------------------------LASRLPGVIAFFS--XGSGEHL..
A5ARG5_VITVI/22-139------------EI-----LAST---------------------------------IWKKLEEIYMLKS--LPNRIYL..
Q9M3C1_ARATH/26-145------------QE-----EGCE---------------------------------PREGYEGNYQTKT--LANMIYL..
A5AJF1_VITVI/465-574------------AK-----SATK---------------------------------LWLKLESLYMTKS--LANRLHK..
A5BLL6_VITVI/78-195------------AK-----SAAE---------------------------------LWLKLESLYMTKS--LGNRLHK..
A5BYU4_VITVI/59-176------------AK-----STVE---------------------------------LWLKLESLYMTKS--LANQLHK..
A5BPE6_VITVI/78-195------------ET-----TAVG---------------------------------LWRKFESKYQKKS--LTNRLYQ..
Q18L98_CITSI/80-198------------EK-----TALG---------------------------------IWNKVETLCMKKS--LAHRLFL..
A5B6C0_VITVI/29-150------------ED-----TTTK---------------------------------LWLKLESLYMTKS--LTNLLNL..
A5AYK3_VITVI/32-152------------ED-----ITAK---------------------------------LWLKLESLHMTKS--LKNRLYL..
A5B8Q0_VITVI/529-644------------EN-----MATK---------------------------------LWLKLESLYMTKS--LTNRLYL..
Q2AA73_ASPOF/71-191------------EK-----TTAD---------------------------------LWSKLEDLYLMKS--LTNRLLL..
A5AM57_VITVI/98-215------------EK-----TIAR---------------------------------VWKKLEGLYRTRA--LPNHIYL..
A5C6J6_VITVI/77-184------------ET-----TAVK---------------------------------VWERLEALYLKRS--LANRLYL..
A5AQ94_VITVI/78-195------------ET-----TAKG---------------------------------VWNKLEQLYMQNS--LSNRLYL..
A5AKU3_VITVI/615-723------------ET-----IIEG---------------------------------VRNKLELLTLYGE--LT.......
C6GFP7_FRAAN/52-171------------TM-----TAKE---------------------------------AWENLESVYKGKS--IGNKLLL..
A5C6L3_VITVI/78-195------------EK-----TTAD---------------------------------LMKALSGMYEKPS--ANNKVHL..
A5BCL0_VITVI/55-172------------EK-----STMG---------------------------------LMKVLSDMYEKLF--ANNKVFL..
A5AL15_VITVI/39-145------------HT-----MYFF---------------------------------LCXRLNATFITVA--L..KVFL..
B9NKT0_POPTR/77-196------------EH-----DCYT---------------------------------VWKMLEETFAKES--AQNKVFV..
Q6RZV5_MUSAC/23-145------------LG-----NSGG---------------------------------DPSSLEQDGKKRK--KRDDHFEGI
Q9ZRJ0_TOBAC/76-193------------VT-----HARS---------------------------------LWDKLEELYASKT--GNNKLFY..
Q5MG99_IPOBA/76-193------------ET-----HARS---------------------------------LWNKLETLYASKT--GNNKLFL..
A5AJF5_VITVI/76-192------------EK-----HARS---------------------------------LWNKLEQLYARKT--GNNKLFL..
A5BEP3_VITVI/54-180------------EK-----HAQS---------------------------------LWNKLKQLYAQKT--SNNKLFL..
B3N452_DROER/17-137------------CT-----TSFE---------------------------------AWTKLREVHQPSG--PVRKVSL..
B4N7F3_DROWI/52-172------------CL-----TEYE---------------------------------AWTRLRDVYQPRG--PVQKVSL..
B6V6Z8_DROME/78-198------------CT-----TSAD---------------------------------AWKKLCDVHLPGG--PIRKVQL..
B4NQE5_DROWI/78-198------------CG-----SARD---------------------------------YWLKLEKTFQSKG--PVRKASL..
Q45W64_PHACH/80-192------------CE-----TAKS---------------------------------AWDTLKNMYATQG--TMAKVTL..
Q5JMV2_ORYSJ/12-126------------AA-----CRTT---------------------------------ADRRLSWCANVHS--TPCYLVL..
A5CA63_VITVI/149-269------------ND-----TTNV---------------------------------VWEALKNAYAKDS--QEREFTL..
Q8W5F6_ORYSJ/80-197------------MT-----DAKE---------------------------------LWDALHTKFGATD--ASNDLYI..
Q8LN71_ORYSJ/50-167------------MP-----SGKD---------------------------------MWDALEAKFGVSD--AGSELYV..
B7ZXP2_MAIZE/242-358------------LP-----TGKE---------------------------------LWDALVGKFGVTD--AGSELYL..
Q10LP7_ORYSJ/115-232------------HT-----SARV---------------------------------LRETLEKKYSVPD--AGKDLYL..
A5BQ76_VITVI/63-180------------VK-----TTKK---------------------------------LWESLEKKYKAED--VGMKKFI..
Q0KIN7_SOLDE/84-201------------YS-----SAKK---------------------------------IWKALQSKYDTEE--AGAKKYA..
B9GJ95_POPTR/36-153------------HR-----SIQA---------------------------------AWDAIKIQYGETS--TTRLCQL..
B9GJ02_POPTR/48-165------------HR-----STQS---------------------------------VWDAVKIQYGGTS--TTRLRQL..
Q7Y173_ORYSJ/18-135------------SD-----DVKT---------------------------------YLENIDRNFRSSS--KSYASSI..
A5B4U1_VITVI/192-309------------HE-----NVRE---------------------------------LLKAIDEQFVTSD--KTLASTL..
Q2R404_ORYSJ/102-219------------SN-----DIKT---------------------------------YLANIEESFEFAP--ETHANTL..
A5BQ76_VITVI/411-528------------MD-----TAYD---------------------------------ILENLKEMFGDQT--SAARQNT..
Q0KIL6_SOLDE/90-207------------ML-----SAFE---------------------------------FLENLKQMFGDQG--QSAKQIA..
Q9SZS9_ARATH/2-131------------AK-----KPKQ---------------------------------LRNKPRKSFSTQT--FTVVVLVLF
B9SXB7_RICCO/3-127------------KA-----RYSR---------------------------------LPARKSSSPTTMI--LTMLLMFTF

PF03732

Q9XX53_CAEEL/210-308------------RK-----FLTFLEGRARNKAGEILAKNQVV..............NFEELVEELRKT---FDNAVLIRH
PEG10_MOUSE/174-267------------CF-----VTSMLIGRAARWATAKLQRCTYL............MHNYTAFMMELKHV---FEDPQRREA
Q9AUY8_ARATH/31-127------------DI-----AIHLLEGDAHNWWLAVDKRKGER............VETFKDFEDEFNRM---YFPSEAWDR
Q9FWC7_ORYSJ/155-249------------SA-----VVLHMSGNAAQWYHSYKLVNEVN..............SWDQFRMAVATE---FEG.VVERE
Q9FE41_ORYSJ/775-871------------AP-----AHVTAEGDPRQHARQHAPRGENP...........SIGNWATMKEVFKKH---FVA.MKKDF
Q9LP90_ARATH/163-253------------AL-----VSVSVSGEALSWYNWAISRGDFV..............SWLKLKSGLMLR---FGNLKLRGP
Q9LMV1_ARATH/257-344------------QI-----FIEHLTGPAHNWFSRLKPNSID...............SFHQLTSSFLKH---YAPLIENQT
Q9ARZ4_ORYSJ/100-192------------KV-----IHLTLDGIARSWYFNLPANSIY...............SWEQLRDVFVLN---FRGTYEEPK
Q9FYC9_ARATH/102-194------------DI-----ASIHFDDIDATWHQSIVQSIMWRH..........VRHDWWNYKLLLQVR---YNK..HVDD
Q9SK57_ARATH/214-310------------DI-----AVHFLEGDAHNWWLTVEKRRGDE............VRSFADFEDEFNKK---YFPPEAWDR
Q9FRJ2_ORYSJ/81-182------------RR-----ADHCV....VNWLHNSIAKNVFDVVYK...PRASAFTVWSDIEGVFRDN---AVQ..RSVY
Q9AV68_ORYSJ/351-443------------NY-----LPVALADSARSWLHGLPRRTIG...............SWAELRDHFIAN---FQGTFERPG
Q9AYB5_ORYSJ/567-664------------SF-----ASHQLLGPASEWWDHFRLNRITA...........EPITWLEFTAAFRKT---HIPSGVVSL
O23529_ARATH/90-186------------RL-----IFSALIGAISPPVQPLVSRATKA............SQIWKTLTNTYAKS---SYD..HIKQ
O82608_ARATH/272-360------------HL-----FVEHLKGPALNWFTRLKGNSVD...............SFQELSTLFLKQ---YSVLIDPST
Q9AYC2_ORYSJ/729-826------------AF-----ATHQLQGPASAWWDNHMATRPPG...........TEVTWVEFCRSFRKA---QVPDGVMAQ
Q9FGL3_ARATH/131-241------------SM-----V........KSWILNSVTKQIYKSILR....FNDAAEIWKDLDTRFHIT---NLP..RSYQ
Q9SQW9_ARATH/264-354------------EK-----AVSCLTGASVTWWRCSKDREQIY..............TWREFQEKFMLR---FRP.SRGSS
Q9LNM2_ARATH/83-178------------HL-----FVEHLKGPALDWFSRLEGNSVD...............SFHELSTLFLKQ---YSVLIDPDT
Q9AYB6_ORYSJ/694-791------------IF-----AAHQLQGPASLWWDHFQATQPEG...........QPITWARFTAAFRRT---HVPAGVVAL
Q9XE67_SORBI/155-252------------GV-----AAHQLTGAARAWWDSYSDTHENP...........GGITWAEFTEAFREQ---HVPEGVMDA
O49369_ARATH/139-231------------GF-----ASLHFDDTAATLHQSIVQSMWWKH..........VRHDWWSYKLLLQVR---YDE.HVNDS
Q9ZPF9_ARATH/97-196------------KV-----AATEFYDYALSWWDQVVTTKRRLGD........DSIETWNQLKNIMKRR---FVPSHYHRE
Q9XII7_ARATH/126-236------------SM-----V........KSWLLNSVSPQIYRSILR....MNDASDIWRDLNSRFNVT---NLP.RTYNL
Q9SIM3_ARATH/131-240------------MV-----KSWLLNSVSPQIYRSILRLNDAT.............DIWRDLFDRFNLT---NLP.RTYNL
Q9MA68_ARATH/89-183------------RL-----FPFSLGDEAHLWEKTLLVDSVD...............TWDDCKKAFLAK---FFSNSRTAR
Q9M225_ARATH/186-282------------DL-----AVHFLEEDAHLWWKSVTARRRQA............DMSWADFVVEFNAK---YFLQDELDR
Q96467_HORVU/82-176------------KL-----FPFSLRDRAKTWFSSLPKSSID...............SWDKCKDAYISK---YFPPAKIIS
Q9AXC5_ANTHI/295-388------------NF-----AAFRLEDAARHWWRILDQRWKNDM..........TPRTWDNFVKEFYNK---YIP.....Q
Q9M0T9_ARATH/89-183------------RL-----FPFSLGDKAHIWEKNLPHDSII...............TWDDCKKAFLSK---FFSNARTAR
Q9SY43_ARATH/188-284------------DL-----TVHFLEGDAHLWWRSVTARRRQA............DMSWADFMAEFNAK---YFPREALDR
Q9C7H8_ARATH/150-242------------KM-----VAIHFDSHAATWHHSFIQSGIGLD..........VFFNWPEYVKLLKDR---FED.ACDDP
Q9ZNW4_SORBI/210-302------------KS-----FVIAAEGDALAWYSMLRPGSIY...............SWENLRDKILAN---FQGFAVESL
Q9SUN0_ARATH/223-313------------QL-----FVEGLTGNALTCFSRLEANSID...............NFTQLSTAFLKQ---YRVFIQPGA
Q9M252_ARATH/163-260------------DI-----IVHFLREEASHWWDGVLGNTPVQ...........HVIFWEDFREEFNRK---FFPQEAMDS
O93283_TAKRU/149-242------------GF-----ITSLLADKALSWAIAAVDLDPRL............SSDYSAFRREFKAV---FEHPTYGED
Q9ZQQ3_ARATH/198-290------------KL-----FSENLCGQALMWFTQLEPGSIS...............NFNELSVVFLKQ---YSILMDKSI
Q9ATX2_MAIZE/179-271------------KS-----FVMAVRSVAQTWYSSLRPGTIT...............SWQKLKDMLLTS---FQGFQTKPV
O81471_ARATH/148-242------------KL-----FPYSLAGEAASWLKQLKAGSLK...............IWRSIKIAFLTN---FYDDAKSEE
Q9FW76_ORYSJ/181-275------------KI-----ATLNFCGNAAFWLQSVRSQLAGA..............TWFELCDRVCGR---FAR.DRKQA
Q9SKF2_ARATH/107-197------------RL-----FPFSLGDRARIWEKNLPQRSIT...............SWDQCKRAFLSK---FFSTTRTAR
Q9SYE8_ARATH/131-230------------KI-----AATKFYNYALSWWDQLVTSRRRTRD........YPIKTWNQLKFVMRKR---FVPSYYHRE
Q98SV9_TAKRU/117-207------------AF-----VVNLLSGRAAQWATAVLENQTPA............SSSFPEFTAELKRV---FDHPIQSGE
Q9SJP0_ARATH/291-382------------QL-----FVKHLSGAALTWFSRLEANSID...............SVHALTTSFLKN---YGVFMEKGA
Q9XE85_SORBI/114-212------------LY-----ASGQLQGAAQTWWESYQAARPNNA..........SPVTWLEFCRDFRAR---HINEGVMEL
Q9ZS84_SOLLC/150-247------------NI-----TTMYLSGDAKLWWRTRNADDVSAGR........PRIDTWDKLIKEMRDQ---FLPSNASWL
O48967_MAIZE/245-337------------TY-----FHVALSGPARTWLMNLSPGSIY...............SWEELYARFVAN---FASAYQQHG
Q9LZG5_ARATH/148-244------------DL-----ASCYLRGEAQEWWERVKQREQVG...........CVDQWSFFKEEFTRR---YLPEETIDD
Q9SX87_ARATH/132-224------------SI-----ASTLCDGAAAKWYKSLFESDFGVK..........LLSNWNMYKLLLEEH---FAE..VLDD
Q9LQH2_ARATH/476-575------------KV-----APTEFQNYALSWWDQLVTTRRRAGD........YPIESWTQMKTIMRKR---FVPSHYYRE
Q9FZN9_ARATH/121-215------------RL-----FPFSLGDKAHQWEKSLLQGSIT...............SWNDCKKAFLAK---FFSNSRTAR
Q9SLQ0_ORYSI/194-290------------RA-----ATSEFTDFASIWWSEFVRSNPNN...........TPQTWDAMKRVMRAR---FVPSYHARD
Q9UVC2_PASFU/52-153------------IF-----ATTFLRGRAQHWVKPFLRKYLDSNGED...NADGVFKSYNHLKHAMKSV---FGVSNEIAT
Q9ZPG6_ARATH/97-191------------RL-----FPFSLGDKAHHWKKTLPPDSIT...............SWDDCKKDFLAK---FFSNARTAR
Q9ZUK1_ARATH/211-302------------KL-----FSENLFGLALTWFTQLEEGSID...............NFKQLSTAFIKQ---YEYFINSDI
Q9FWB1_ARATH/104-198------------KL-----FSFSLADKTHRLFKSMNPENLR...............SWEDYKAAFLTQ---YFTQSRTAI
Q9HFY8_COLGL/148-252------------VH-----AATFLRGRALAWFEPLQQEWLDNPVEKYSQEVRNIFFSFDGYVKALQSL---FLDPDEKRQ

PF03564

O17518_CAEEL/85-228------------FK-----GESW---------------------------------EFQNFWVLFEELVHK.TDMPDMVK
A7SE42_NEMVE/491-638------------FA-----GSVG---------------------------------EWQEFWDGFESSIHSNPRLATVDK
Q17051_9BILA/155-293------------FS-----GNPK---------------------------------EWTGFWETFNSAV...GHLPKIQC
Q23992_DROME/160-308------------FF-----GDSK---------------------------------EWDLFNELFTELIHVREDLSPSLK
O16669_CAEEL/141-284------------FS-----GDIL---------------------------------HFQSFMELFNTLIDS.QPIAEIFK
A7XDH0_DROAN/157-302------------FG-----GIYK---------------------------------EWPAFKALYISTVHSKQHLGKIQK
Q4JS97_ANOGA/133-280------------FD-----GEIT---------------------------------KWLTFKDRFSSMVHDSTEMPEVLK
Q4EAY5_9RICK/161-306------------FS-----GDYK---------------------------------EWPAFWDIYKSTIHKKRQLSDTQK

PF14893

MOAP1_HUMAN/1-327M....TLRLLEDWC-----RGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDE--NRKVALVGL
D3ZGB3_RAT/1-321M....ALAILQDWC-----GWMGVNAQRSLLILGIPDDCGEEEFQEAVQAALRPLGRYRVLGKVFRKEI--GAKVALVEF
PNM6B_HUMAN/1-320M....AVTMLQDWC-----RWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKVFREED--NATAALVEL
PNML1_PONAB/1-365MSKTMAMNLLEDWC-----RGMEVDIHRSLLVTGIPEDCGQAEIEETLNGVLAPLGPYRVLNKIFVREE--NVKAALIEV
PNML1_MOUSE/1-364MSEPVAMTLLEDWC-----RGMGMDIHRSLLVTGIPEYCSHAEIEETLNGVLLPLGTYRVLNKIFLRQE--NVKAALVEV
D2GZV4_AILME/1-326M....AMTLLEDWC-----RGMDVNSQRALLVWGIPVNCDEAEIEETLQAAM.PQVRYRVLGRMFWREE--NAKAALLEL
D2I1P4_AILME/1-328M....ALAMLRDWC-----RWMGVNAHRSLLILGIPDDCGEEEFQKAVHAALWPLGGYRVLGKVFRKEL--GSRVALVEF
Q5BJV6_RAT/1-329M....TLRLLEDWC-----RGMDMNPRKALLVAGIPPTCGVADIEEALQVGLAPLGEHRLLGRMFRRDE--NKNVALVGL
F1PEY7_CANFA/1-297V....PLAILHDWC-----RWMGVNAHRSLLILGIPDDCEEEEFQDAVKAALWPLGRYRVLGKAFRKEL--GSRVALVEF
PNMA3_HUMAN/1-328M....PLTLLQDWC-----RGEHLNTRRCMLILGIPEDCGEDEFEETLQEACRHLGRYRVIGRMFRREE--NAQAILLEL
PNMA5_MOUSE/1-324M....AVALLDDWC-----KGMDLDPKKAVLIVGIPVQYTEAAINDALKEGLPPLCAYKVIGRMFRRED--EAKAVLIEL
PN6BL_HUMAN/1-327M....ALAMLRDWC-----RWMGANAERSLLILGIPDDCKEHEFQEAVRAALSPLGRYRVLTKHFRKEL--GAKAALVEF
PNMA5_HUMAN/1-323M....ALTLLEDWC-----KGMDMDPRKALLIVGIPMECSEVEIQDTVKAGLQPLCAYRVLGRMFRRED--NAKAVFIEL

PF14244

A5AE14_VITVI/10-125.KQP.DNDS.PE...LEDWWTINSMLVSW.....--.---......----------------------------------
A5AFL1_VITVI/24-172.EPP.KKDD...K.RFKVWNTENNLVMSWLINAM--D---TEIGQN----------------------------------
A5AL35_VITVI/26-142.TGP.QPP..YT...QSDWNTVNAMLVSWITNTI--D---PE....----------------------------------
A5APA9_VITVI/42-180PPPP.PQTD...P.SFXKWCTDNAIT........--.---..LIGN----------------------------------
A5AR29_VITVI/23-171.AAP.ETTT...S.TYKKWIAENNMVMSWLVNSM--T---ADIGEN----------------------------------
A5ARJ9_VITVI/24-165.TAL.AKND...A.SYKTWFSKNNMIMSWLTNSI--E---TDVGQT----------------------------------
A5ATA8_VITVI/24-171.PQP.LTTD...P.XFRRWRTENATVKGWLIGSM--D---PSLIGN----------------------------------
A5AW26_VITVI/23-156.KVP.KTTN...P.LFESWDFENSMIMSXLLNYM--Q---PEIGKT----------------------------------
A5AXC5_VITVI/8-148.SKPINDRDEKYIDMLESXEANNSKIXIXINNFX--E---HSIGIQ----------------------------------
A5AZ64_VITVI/47-175.KAP.LEET.HPD.DYATWSRCNDMVHSWIVNTL--N---PEISDF----------------------------------
A5AZK9_VITVI/143-291.KAP.KTTN...P.LFELWDSENSMIMSWLLNSI--Q---PEIGKP----------------------------------
A5B0N9_VITVI/37-186.NPP.KESK...D.GYEKWYAKNQKVKRWLLMSM--S---REIMKR----------------------------------
A5B3L9_VITVI/16-147.XTP.LEDD...P.KFQMWDSENFMIISWLINSM--E---SEIGQT----------------------------------
A5B8L2_VITVI/15-147.PPP.PQTY...P.SFRKWRIDNMSPFPSIDQAY--A---HVHI..----------------------------------
A5BAZ3_VITVI/31-163.VMP.ETTK...L.GFRKWKIENSMIMSWLINSM--N---NDI...----------------------------------
A5BCQ9_VITVI/83-209.KPP.SSTD...D.SFPSWQRCNDM.........--.---......----------------------------------
A5BG06_VITVI/43-189.PQP.STID...P.FFRRWRNENTTVKGWLIGSM--D---PSLIGN----------------------------------
A5BJC0_VITVI/21-165.TGP.KLGD...P.HFEAWDEEDFMIMAWLWNSM--T---SEISNT----------------------------------
A5BKK0_VITVI/191-331.PQP.LETD...P.YFRKWWIENAIVNGWLINSM--E---SSLVRN----------------------------------
A5BM32_VITVI/27-149.VQP.ITND..PH.LRVAWLRANNL.........--.---......----------------------------------
A5BN45_VITVI/28-176.AIL.EKTD...P.KFRVWKTKNHMVMSWLINLM--N---TDIGEN----------------------------------
A5BNR5_VITVI/308-456.EEP.SQED..EPFMFEQWNQCNSMILSWLTHAV--E---SDIAEG----------------------------------
A5BP26_VITVI/33-181.PCP.ESDD...L.LFGTWIRCNSMVISWILNSV--H---KDIADS----------------------------------
A5BQW4_VITVI/215-363.TKP.TTND...L.FLKKWQSESSLVIAWFINSM--E---LAIGKP----------------------------------
A5BSG2_VITVI/5-152.VAP.VEND...P.NYDEWKVEDVLVKSWXINSM--I---DKLMSH----------------------------------
A5BT41_VITVI/40-187.PQP.LQTD...P.AFKKWRTENAMVKGWLINSM--D---PKLVSN----------------------------------
A5BVQ3_VITVI/17-164.PQP.PETD...P.SFRRWRTENAIVKGWLINSM--D---PSLIAN----------------------------------
A5BWZ5_VITVI/42-189.PQP.PETD...P.SFRRWRTKNAIVKGWLINSM--D---PSLIAN----------------------------------
A5BXA9_VITVI/396-529.AMP.KTTE...P.GFRKWKIENSMIMSWLINSM--N---NDIA..----------------------------------
A5C3H8_VITVI/42-155.PPP.PRAD...P.SFRKWRTTNAIV........--.---......----------------------------------
A5C4L4_VITVI/24-140.KTP.SEEI.DPK.GYATWSRCNDTVHSWIVNTL--N---PEIANS----------------------------------
A5C4S3_VITVI/27-177.SRL.AATD...L.LAGLWSRCNSMVISWLSNSV--C---KEIAES----------------------------------
A5C9I0_VITVI/13-150.SRA.AQTN...L.LFNAWNRCNSMVTSWIINSV--S---KDIVDS----------------------------------
B9SLN1_RICCO/35-176.EPP.SKEK.HPD.SYGSWSRCNDMVHSWIINTL--D---PKIADN----------------------------------
O22175_ARATH/27-174.PKP.AADP.....ELSLWIAINSMIVGWIRTSI--D---PTIRST----------------------------------
O23588_ARATH/73-209.PRP.DVSD...R.MFKIWSRCNSMVKTWLLNVV--T---......----------------------------------
Q0PY40_SOLLC/17-166.TRA.LYKD...E.LHEQWETCNAIVLSWLMNTV--S---EELLSG----------------------------------
Q2HT49_MEDTR/20-168.SVP.DIDD...L.NRQAWERCNHLIHSWIVNSV--T---ESIAQT----------------------------------
Q2HU07_MEDTR/24-172.PIP.PMDD...L.NRTAWERCNNLILSWIINSV--S---PQIAQT----------------------------------
Q6L4J8_SOLDE/13-160.TQP.KEEG.FE...LDDWYAVNSMLIVWVFNTI--D---PSLRST----------------------------------
Q9FIC5_ARATH/29-177.PQP.DETN.PD...FDDWIANNALVVSWMKLTI--H---ESLATS----------------------------------
Q9LGZ8_ARATH/19-166.PKP.TTEP.....ALSSWKAANSMIIGWIRTSI--D---PTIRST----------------------------------
Q9M0P5_ARATH/20-169.PQP.PSTH...R.DAGSWSRCNDMVATWLMNSV--S---KKIGQS----------------------------------
Q9XIM3_ARATH/23-161.PRP.LETD...K.NFCLWSRCNSMIC.......--.---....RS----------------------------------
Q9ZPU4_ARATH/37-185.PRP.PPND.PN...YENWTAVNSMIVGWIRTSI--E---PKVKAT----------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A0EVF5_MAIZE/104-132--------------------------------------------------------------------------------
A0EVG6_MAIZE/136-164--------------------------------------------------------------------------------
A0MEB8_ARATH/13-39--------------------------------------------------------------------------------
A2I5F8_BETVU/19-47--------------------------------------------------------------------------------
A2Q2M0_MEDTR/28-56--------------------------------------------------------------------------------
A2Q5V3_MEDTR/14-42--------------------------------------------------------------------------------
A2XQ14_ORYSI/37-63--------------------------------------------------------------------------------
A5ACV7_VITVI/14-40--------------------------------------------------------------------------------
A5ACV9_VITVI/13-39--------------------------------------------------------------------------------
A5ADA3_VITVI/15-41--------------------------------------------------------------------------------
A5AE45_VITVI/21-49--------------------------------------------------------------------------------
A5AFP3_VITVI/14-39--------------------------------------------------------------------------------
A5AGS2_VITVI/15-41--------------------------------------------------------------------------------
A5AHH2_VITVI/133-159--------------------------------------------------------------------------------
A5AHJ1_VITVI/21-49--------------------------------------------------------------------------------
A5AKW8_VITVI/13-39--------------------------------------------------------------------------------
A5AMT2_VITVI/33-58--------------------------------------------------------------------------------
A5ANP1_VITVI/21-49--------------------------------------------------------------------------------
A5ANX8_VITVI/14-40--------------------------------------------------------------------------------
A5AVP1_VITVI/15-40--------------------------------------------------------------------------------
A5AWN8_VITVI/13-39--------------------------------------------------------------------------------
A5AX99_VITVI/16-44--------------------------------------------------------------------------------
A5B0F2_VITVI/14-40--------------------------------------------------------------------------------
A5B1X3_VITVI/15-41--------------------------------------------------------------------------------
A5B3E3_VITVI/45-71--------------------------------------------------------------------------------
A5B612_VITVI/21-49--------------------------------------------------------------------------------
A5B8H9_VITVI/78-103--------------------------------------------------------------------------------
A5BB46_VITVI/210-235--------------------------------------------------------------------------------
A5BD08_VITVI/13-39--------------------------------------------------------------------------------
A5BLB0_VITVI/214-240--------------------------------------------------------------------------------
A5BLE1_VITVI/15-41--------------------------------------------------------------------------------
A5BM96_VITVI/21-49--------------------------------------------------------------------------------
A5BNN7_VITVI/10-36--------------------------------------------------------------------------------
A5BP60_VITVI/21-49--------------------------------------------------------------------------------
A5BQA9_VITVI/73-99--------------------------------------------------------------------------------
A5BRW6_VITVI/14-40--------------------------------------------------------------------------------
A5BSL1_VITVI/14-39--------------------------------------------------------------------------------
A5BTH8_VITVI/21-49--------------------------------------------------------------------------------
A5BV67_VITVI/23-49--------------------------------------------------------------------------------
A5BVS1_VITVI/10-36--------------------------------------------------------------------------------
A5BXS1_VITVI/15-41--------------------------------------------------------------------------------
A5C0Q9_VITVI/16-42--------------------------------------------------------------------------------
A5C3F9_VITVI/15-41--------------------------------------------------------------------------------
A5C3G4_VITVI/99-125--------------------------------------------------------------------------------
A5C753_VITVI/21-49--------------------------------------------------------------------------------
A6FWP0_9RHOB/12-38--------------------------------------------------------------------------------
A6YTD9_CUCME/15-41--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B6REL1_9BRAS/2-28--------------------------------------------------------------------------------
B6REL9_9BRAS/23-49--------------------------------------------------------------------------------
B6REM4_9BRAS/12-38--------------------------------------------------------------------------------
B6TPM7_MAIZE/33-59--------------------------------------------------------------------------------
B6V6Z8_DROME/10-36--------------------------------------------------------------------------------
B8BDZ6_ORYSI/26-52--------------------------------------------------------------------------------
B9FWJ4_ORYSJ/161-187--------------------------------------------------------------------------------
B9GKP2_POPTR/14-40--------------------------------------------------------------------------------
B9GSJ3_POPTR/134-160--------------------------------------------------------------------------------
B9HE40_POPTR/16-42--------------------------------------------------------------------------------
B9HFW3_POPTR/15-41--------------------------------------------------------------------------------
B9HGE2_POPTR/14-40--------------------------------------------------------------------------------
B9HKW4_POPTR/29-55--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
B9HPY3_POPTR/20-46--------------------------------------------------------------------------------
B9I2Y2_POPTR/15-41--------------------------------------------------------------------------------
B9I573_POPTR/13-39--------------------------------------------------------------------------------
B9IBK8_POPTR/14-40--------------------------------------------------------------------------------
B9IK76_POPTR/27-53--------------------------------------------------------------------------------
B9MXT9_POPTR/15-41--------------------------------------------------------------------------------
B9NB79_POPTR/15-41--------------------------------------------------------------------------------
B9NCJ4_POPTR/14-40--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9NL03_POPTR/15-41--------------------------------------------------------------------------------
B9P6D1_POPTR/13-39--------------------------------------------------------------------------------
B9P7V6_POPTR/11-37--------------------------------------------------------------------------------
B9PAL4_POPTR/13-39--------------------------------------------------------------------------------
B9PCS7_POPTR/28-54--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C0JJI1_SOYBN/14-40--------------------------------------------------------------------------------
C1IJC5_HORVU/51-77--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
D3IVE4_9POAL/157-183--------------------------------------------------------------------------------
D3IVI1_9POAL/13-41--------------------------------------------------------------------------------
Q01L11_ORYSA/14-42--------------------------------------------------------------------------------
Q01L55_ORYSA/55-83--------------------------------------------------------------------------------
Q01LI0_ORYSA/9-35--------------------------------------------------------------------------------
Q01MW9_ORYSA/19-45--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q0WNA8_ARATH/12-38--------------------------------------------------------------------------------
Q10B81_ORYSJ/39-67--------------------------------------------------------------------------------
Q10F54_ORYSJ/861-887--------------------------------------------------------------------------------
Q10PG0_ORYSJ/12-40--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q25AF6_ORYSA/59-85--------------------------------------------------------------------------------
Q2QS45_ORYSJ/14-42--------------------------------------------------------------------------------
Q2R0F7_ORYSJ/478-504--------------------------------------------------------------------------------
Q4ABY7_BRACM/25-51--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q6L3N8_SOLDE/17-43--------------------------------------------------------------------------------
Q6XMP8_AEDAL/16-42--------------------------------------------------------------------------------
Q710T7_POPDE/16-42--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XH44_ORYSJ/104-130--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q84VH6_SOYBN/16-44--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
Q8H6I0_MAIZE/134-162--------------------------------------------------------------------------------
Q8H6I4_MAIZE/130-158--------------------------------------------------------------------------------
Q8H6W2_CICAR/19-47--------------------------------------------------------------------------------
Q967L5_AEDAE/11-37--------------------------------------------------------------------------------
Q9C7Y1_ARATH/12-37--------------------------------------------------------------------------------
Q9LE43_ARATH/25-51--------------------------------------------------------------------------------
Q9LH44_ARATH/12-38--------------------------------------------------------------------------------
Q9LIG4_ARATH/14-40--------------------------------------------------------------------------------
Q9LJ55_ARATH/26-52--------------------------------------------------------------------------------
Q9LJD1_ARATH/12-38--------------------------------------------------------------------------------
Q9LJD2_ARATH/12-38--------------------------------------------------------------------------------
Q9LNQ5_ARATH/22-48--------------------------------------------------------------------------------
Q9M1C6_ARATH/15-40--------------------------------------------------------------------------------
Q9MAR7_ARATH/25-51--------------------------------------------------------------------------------
Q9SKV6_ARATH/22-48--------------------------------------------------------------------------------
Q9XEB1_ARATH/10-36--------------------------------------------------------------------------------
Q9XEB1_ARATH/348-376--------------------------------------------------------------------------------
Q9ZQE9_ARATH/12-38--------------------------------------------------------------------------------
Q9ZTG6_TOBAC/19-47--------------------------------------------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204AMRTLMNT-----------------KMVEGTP-V--R---DHVLKM----------------------------------
A5BQ76_VITVI/412-525TLREILTS-----------------KMEEGTQ-V--R---THVLKM----------------------------------
A5AHT8_VITVI/92-205ILSKFVSI-----------------RYKGKEN-I--R---EYIMEM----------------------------------
B8BH64_ORYSI/219-332LLAKLISM-----------------RYKGKGN-M--R---EYIMEM----------------------------------
A5BI38_VITVI/288-401LVMKFSSL-----------------RLTDVSG-V--R---EHIMQV----------------------------------
B9GJ95_POPTR/37-150LILKFDGY-----------------KKHQNQT-M--R---QYFIIM----------------------------------
A5ANU6_VITVI/96-209LISQYIDF-----------------KFFDEKP-L--L---PQIHEL----------------------------------
A5B8Q0_VITVI/530-643LKKRLHTL-----------------HMKKFMS-I--K---DLLDEF----------------------------------
A5AQ94_VITVI/79-192LKERLYGF-----------------KMQEDRS-I--A---DNLDDF----------------------------------
Q18L98_CITSI/81-195LKKRLYTF-----------------SMREGVT-I--Q---DHIDTF----------------------------------
Q1KUM3_9ROSI/118-231LMQRVSGF-----------------RMDSSRT-I--E---ENLDIF----------------------------------
Q7XTM9_ORYSJ/78-191LKQKLFLH-----------------KLQDDGS-V--M---DHLSAF----------------------------------
Q01M93_ORYSA/78-191MKMKLFTL-----------------KMKEEDS-V--I---THIAEF----------------------------------
A5AS33_VITVI/79-194LMKILFNL-----------------NMTENAS-V--A---QHLNEF----------------------------------
Q2AA06_ASPOF/860-974LLRRLFRF-----------------QMSRGTS-L--A---AYVNNY----------------------------------
Q6XMP8_AEDAL/82-196IRKQIARL-----------------HLKDGAS-V--R---AHLLQF----------------------------------
D2A543_TRICA/77-191LRKKLLTM-----------------KLSSNDT-M--E---KHFLKF----------------------------------
Q9U6V8_DROWI/75-189LRKRLLSL-----------------KLSSEMS-L--L---SHFHIF----------------------------------
A5BIJ4_VITVI/84-197LKTTLART-----------------N.MDTMS-V--S---EYLMTI----------------------------------
Q0ZCD8_POPTR/118-230LKEELTLI-----------------K.RDNKT-V--Q---EYLHIV----------------------------------
A5B6L3_VITVI/126-238YKSQMHML-----------------K.KDGLT-M--R---DYLTKM----------------------------------
A5BYA6_VITVI/62-174FKTQFQHT-----------------K.KGGST-I--D---EYLAKI----------------------------------
A5BK17_VITVI/103-215FKTQLHNT-----------------K.KGDLS-I--S---DYLLKI----------------------------------
A5CAE5_VITVI/64-176LRLAFQTT-----------------K.KGSLT-M--M---EYIQKL----------------------------------
A5BJ70_VITVI/81-193LRLEFQTT-----------------K.KGGDS-M--L---DYILKM----------------------------------
A5BFR8_VITVI/115-227LRLELQST-----------------K.KGSMS-M--I---DYIMKI----------------------------------
Q9SV56_ARATH/103-217LQRRLNPV-----------------S.KNEKS-M--L---EYLNCV----------------------------------
Q9SSB1_ARATH/101-216LQRRLQTL-----------------E.KKDNT-M--E---VFLKDL----------------------------------
D1GEF6_BRARP/107-222LQRKLQTT-----------------A.KQDKS-M--D---DYLRDI----------------------------------
C0SQ79_PORYE/115-228LEEALATL-----------------RKQPNET-I--M---EYVGRT----------------------------------
A5B3I2_VITVI/89-207LRKEFELL-----------------HMKAGES-V--N---EYFART----------------------------------
A5B8H9_VITVI/153-271LRKEFEML-----------------NMKVGES-V--N---EYFART----------------------------------
A5BGM4_VITVI/89-207LRSEFETL-----------------RMKPGES-V--S---DYFSRT----------------------------------
Q9M1C6_ARATH/91-209LRKEFELL-----------------AMKEGEK-I--D---TFLGRT----------------------------------
A5BYF7_VITVI/162-280LRKEFEIL-----------------QMKEGEK-V--D---EYFAKG----------------------------------
A5BY31_VITVI/28-146LRRDFETL-----------------EMKSGEC-I--T---DYFSRV----------------------------------
A5BFQ9_VITVI/28-146LRREFETL-----------------EMRSGEG-V--T---EYFFRV----------------------------------
Q9C7Y1_ARATH/87-205LRRSFEVL-----------------EMKIGET-I--T---GYFSRV----------------------------------
A5AMT2_VITVI/80-198LRSEFEML-----------------RMTSGEL-V--I---DYFSRT----------------------------------
Q2QXM6_ORYSJ/85-203LRRQFQNL-----------------LMKESEK-V--K---DYFSRV----------------------------------
Q6L3N8_SOLDE/84-202LRRDFETL-----------------FMNENES-V--Q---GYLSRT----------------------------------
A6YTD9_CUCME/91-209LRSEFDCI-----------------KMKETET-I--E---EFFNHI----------------------------------
Q9M2D1_ARATH/89-207LRGEFEAL-----------------QMKEGEL-V--S---DYFSRV----------------------------------
B9IN28_POPTR/105-223VRADFEYL-----------------RMSENES-L--D---GYLAKF----------------------------------
A5BLB0_VITVI/283-400LRRELENM-----------------KMKENET-L--N---EFSSKF----------------------------------
Q9LH44_ARATH/87-205LRREYENL-----------------KMEEGET-I--N---DFTTKL----------------------------------
Q9ZQE9_ARATH/91-209LRREYENL-----------------KMYDNDN-I--K---TFTDKL----------------------------------
A5B9M8_VITVI/90-208LKREFELM-----------------KMKDDES-V--K---DYSGRL----------------------------------
A5BRD1_VITVI/91-209LIREFEMQ-----------------RMKELET-I--K---DYSDRL----------------------------------
A5B779_VITVI/91-209LIREFEML-----------------KMKETET-I--K---DYSDKL----------------------------------
Q9SEL2_VITVI/89-207LIREFEMK-----------------KMRESDA-V--K---DYAAQL----------------------------------
A5BFD6_VITVI/89-207LIREFEMV-----------------RMKESQT-I--K---DYAEQL----------------------------------
B9N6H7_POPTR/91-209LKQEFELQ-----------------RMKESET-I--K---EYSNRL----------------------------------
B9HFW3_POPTR/91-209LIREFELQ-----------------RMKESGT-I--K---EYSNRL----------------------------------
B9P8C1_POPTR/91-209LMRDFELQ-----------------KMKKTES-I--K---EYSDRL----------------------------------
A5BRW6_VITVI/90-208LKRDFKSL-----------------TMKEDET-I--T---KYSDRI----------------------------------
Q6L3X6_SOLDE/202-320LKREFECL-----------------NMQDDET-I--S---KYADRI----------------------------------
A5ACV7_VITVI/90-208LKRQFEVL-----------------RMKDNEF-I--K---EYVDKL----------------------------------
Q6L3Y5_SOLDE/89-207LRKEFEML-----------------RMKETEK-V--K---DYIDRI----------------------------------
Q60EG1_ORYSJ/85-201MKGEFASM-----------------VMEAGES-L--D---QYAGRI----------------------------------
C6JSM1_SORBI/92-210LKSEFDAM-----------------RMKDEES-L--D---QYVGRL----------------------------------
B6TPM7_MAIZE/94-212LKGEFDKL-----------------YMEDEEA-L--D---DYAGKI----------------------------------
Q9SHT5_ARATH/47-166LMAEFDRL-----------------NMKDNET-I--D---EFVGRI----------------------------------
Q9ZUF2_ARATH/41-160LMAEFDKL-----------------KMKDNET-I--D---ECAGRL----------------------------------
Q4ABY7_BRACM/83-202LMAEFDRL-----------------KMKEADT-I--D---YFVGKL----------------------------------
Q9LQK3_ARATH/80-199LMAEFEKI-----------------KMKETEK-I--D---DFAGKL----------------------------------
Q9SKV6_ARATH/80-199LMAEFEKM-----------------KMKESEK-I--D---VFAGRL----------------------------------
Q9LE43_ARATH/83-202LMNEFDRL-----------------KMKDSEN-I--E---AFSGRL----------------------------------
B6REL9_9BRAS/81-200LTYEFERL-----------------RMNDSDS-I--D---AFSGKL----------------------------------
B6REL1_9BRAS/60-179LNSEFDRL-----------------VMKDSDI-I--D---NFAGNL----------------------------------
B9PCS7_POPTR/86-204LKRQLYKV-----------------HMQDSET-V--N---EYSMKL----------------------------------
Q7F814_ORYSJ/95-213LKRELDGM-----------------YMSNSEK-I--N---DFALKV----------------------------------
B8BA29_ORYSI/100-218LHSDFDNL-----------------KMSDVES-V--D---DFAAKF----------------------------------
D3IVE4_9POAL/219-337LHTEFENL-----------------QMGETQS-V--D---EFVGKL----------------------------------
Q7X7K3_ORYSJ/176-294LRREFGDI-----------------IFKDGET-V--D---DFSMRI----------------------------------
Q0J5Y3_ORYSJ/115-233LRREFAAL-----------------TWKEGET-A--E---DFSVRI----------------------------------
Q7XH44_ORYSJ/165-269LRREFADA-----------------RFKDGEN-I--D---DFSMRI----------------------------------
Q2QYR6_ORYSJ/52-170LRQDFAAI-----------------TFKPSER-V--E---EFSLRL----------------------------------
Q5TKD7_ORYSJ/109-227LRSQYEAI-----------------QFKDGET-V--E---DFALRL----------------------------------
Q7XTU6_ORYSJ/114-232FRRQFESM-----------------RFKERET-P--E---EFAMRL----------------------------------
Q8LMZ0_ORYSJ/135-253LRNEFELI-----------------RMKESES-V--D---EFSMRL----------------------------------
Q7G5Z8_ORYSJ/110-228LRKEFELI-----------------RMKEGES-V--D---DFAMRL----------------------------------
Q53P77_ORYSJ/86-204LRSEYEAL-----------------AFRDGES-V--E---DFAMRL----------------------------------
Q2QZL2_ORYSJ/49-167VRAEYESL-----------------AFRGDET-V--E---DFALRL----------------------------------
Q7XWP2_ORYSJ/116-231VRTEYERI-----------------AFRDGES-V--E---EFAMWL----------------------------------
Q10C26_ORYSJ/22-139FLRQYDAI-----------------EFKEGES-V--E---DFSLRL----------------------------------
Q7XUD9_ORYSJ/115-233LQKQYDAM-----------------EFKDGET-V--E---EFSLRL----------------------------------
Q25AF6_ORYSA/117-235LRREYESI-----------------SFHDGES-I--D---DFALRL----------------------------------
C1IJC5_HORVU/114-232LRGEFDQL-----------------RHKSGES-I--D---ELAMRL----------------------------------
C5Y7F6_SORBI/35-153LLAEFESI-----------------AFKLGEA-I--D---DFAVRI----------------------------------
Q94I41_ORYSJ/94-212LMKQFENM-----------------AFRDGEN-V--G---DFAMRI----------------------------------
C5XUK3_SORBI/218-337LRRDWENI-----------------SVNPGEQ-V--E---DFAMRL----------------------------------
C5XQM0_SORBI/100-219LRKEWENL-----------------SFRPREQ-I--E---DFALRL----------------------------------
Q9AUM6_ORYSJ/569-688LRQDWENL-----------------AFKPGED-I--D---DFVLRL----------------------------------
Q2QWI2_ORYSJ/47-166LRKEWENL-----------------AFKPGED-V--D---DFALRL----------------------------------
C5Z583_SORBI/100-218LRRELNDS-----------------KFKPGES-V--E---DFTLRL----------------------------------
C5WNA6_SORBI/224-342LKQEYANL-----------------KFKDRES-V--E---EFSLRL----------------------------------
D3IVP8_9POAL/630-749FKKEYSKF-----------------EMKPGES-V--D---ALFDRF----------------------------------
D3IVT7_9POAL/58-177LKKEYSKI-----------------EQRPGES-L--D---ELWGRF----------------------------------
D3IVI1_9POAL/86-205FKREYNKF-----------------EMLAGES-L--D---ECFSRF----------------------------------
Q10PG0_ORYSJ/85-204FHKEYQRF-----------------EMHPGES-I--D---SYFKRF----------------------------------
D3IVI3_9POAL/99-218FKSEYNKF-----------------EMRLGES-I--D---DVFSRF----------------------------------
Q5H9X1_ORYSJ/112-231LKGQFERF-----------------VMLDGEI-P--S---DMYDRL----------------------------------
Q10NE5_ORYSJ/129-248LEGRLGRF-----------------MMDDKET-P--Q---EMYDRM----------------------------------
C5WYF6_SORBI/63-181MMAKLNRF-----------------VIVGDEG-P--Q---EMFDRL----------------------------------
Q8S467_MAIZE/138-257IEGELGRF-----------------RLRQGEE-P--Q---DMYNRL----------------------------------
Q8H6I4_MAIZE/204-323LESELARY-----------------DWTKGES-L--Q---SLFDRL----------------------------------
Q33BC8_ORYSJ/86-203LKIQYETF-----------------SMLPHES-V--N---DMYGRL----------------------------------
A2Q5V3_MEDTR/101-218LTTKFESL-----------------KMQEDET-I--Q---DYYMNV----------------------------------
O65147_SOYBN/76-194LATKFENL-----------------KMKEEEC-I--H---EFHMNI----------------------------------
A5BZ48_VITVI/103-221LTSRFETI-----------------RMEDHEN-F--G---EFYAKL----------------------------------
Q9XEB1_ARATH/433-551LASEFENL-----------------TMEAEES-V--D---DFNGKL----------------------------------
Q9FG84_ARATH/101-219LASQFENL-----------------TMDESEN-I--E---EFSGKI----------------------------------
Q9ZV83_ARATH/82-200IATQFEYL-----------------KMEPDEK-I--V---KFSSKI----------------------------------
A2I5F8_BETVU/104-223LMNQYELF-----------------CMKSKES-I--R---DMFTRF----------------------------------
A5BW11_VITVI/73-191LVHNYELF-----------------SMKETET-I--V---EMITRF----------------------------------
Q1S5J6_MEDTR/118-236LVHQYELF-----------------RMKDDES-I--E---EMYSRF----------------------------------
Q9FJT0_ARATH/33-146LKKEYNNT-----------------TMSDAET-V--H---EFTGKL----------------------------------
Q9LJD1_ARATH/93-210LEKQLEDL-----------------KMVDKES-G--S---SYLDKA----------------------------------
Q9LJD1_ARATH/509-622LEKQFEEL-----------------SMNEGEP-I--N---PYIDRV----------------------------------
Q9LJC8_ARATH/91-202LEKQFEKL-----------------MMYEGEP-M--D---LYLKRV----------------------------------
Q9LJC9_ARATH/91-203LEKQLENL-----------------TMYEGER-M--K---SYLKRV----------------------------------
A9TSN8_PHYPA/23-136ILDKWENL-----------------SMTDKMT-I--S---IFMQNV----------------------------------

PF14227

A5BY76_VITVI/104-226LVHNYELF--------------...SMKENEA.I--V...EMITRF----------------------------------
A5B9Z7_VITVI/12-134LVHNYELX--------------...SMKESES.I--V...EMITRF----------------------------------
A5BSC1_VITVI/688-789........--------------............--.....LLIRF----------------------------------
A5BWL8_VITVI/342-448LRSRFDRG--------------...PVKDNET.I--V...EMITWF----------------------------------
A5BLR1_VITVI/94-215GLSRY.LN--------------...RRYENET.I--V...EMITRF----------------------------------
A5BLB0_VITVI/282-404LRRELENM--------------...KMKENET.L--N...EFSSKF----------------------------------
Q9LJC9_ARATH/90-212.EKQLENL--------------...TMYEGER.M--K...SYLKRV----------------------------------
Q5AT23_EMENI/392-511.IRKVTRW--------------...QMDPKMS.L--EGAMQQLDQY----------------------------------
D3IVP8_9POAL/629-752FKKEYSKF--------------...EMKPGES.V--D...ALFDRF----------------------------------
COPIA_DROME/74-192.RKRLLSL--------------...KLSSEMS.L--L...SHFHIF----------------------------------
D2A543_TRICA/76-194.RKKLLTM--------------...KLSSNDT.M--E...KHFLKF----------------------------------
O96968_BOMMO/78-193.RKKLLTL--------------...KCDPSVE.L--S...DHFNNF----------------------------------
Q6XMP8_AEDAL/81-199.RKQIARL--------------...HLKDGAS.V--R...AHLLQF----------------------------------
B0X5G3_CULQU/101-222.MQKMCSL--------------...KLQEDGN.L--P...EHLKKL----------------------------------
Q967L5_AEDAE/76-197.LKKLCAI--------------...NLSERGD.L--E...QHLFEV----------------------------------
Q8WRX6_ANOGA/74-195.LKKLCKA--------------...EYDESGD.M--E...AHLFRM----------------------------------
B2CN78_DAPPU/42-160.QQKFFEY--------------...QYQPEHD.I--M...AHITEV----------------------------------
A9RF54_PHYPA/34-146.AHKFFTV--------------...KMEEGED.L--M...AHVNKV----------------------------------
Q8H023_ORYSJ/210-330.KQQLYGL--------------...QMQEESD.L--R...KHVDVF----------------------------------
Q7XSZ1_ORYSJ/103-219.NSTVNS.--------------...HMQEESD.L--R...KHVDVF----------------------------------
Q7XLX2_ORYSJ/160-253.KQKLYGL--------------...KMQEGAD.L--T...AHVNVF----------------------------------
A5BPQ9_VITVI/512-624........--------------...KMVEGSD.L--S...QHINVF----------------------------------
A5B864_VITVI/32-156.KQKLYGL--------------...KMVEGSN.L--S...QYINVL----------------------------------
Q9AU17_SOLCI/79-196.KKQLYTL--------------...HMDEGTN.F--L...SHLNVL----------------------------------
B1N668_SOLLC/75-192.KQRLFGL--------------...RMAEGTQ.L--R...EHLEQL----------------------------------
Q2AA06_ASPOF/859-977.LRRLFRF--------------...QMSRGTS.L--A...AYVNNY----------------------------------
B9NAJ4_POPTR/37-154.KKRIFRF--------------...QHKKGSS.M--N...EHLNDF----------------------------------
Q69FA7_PHAVU/58-175.KKRLFRF--------------...DYQQGTT.M--N...AHITMF----------------------------------
Q6BCY1_IPOBA/74-193.KRKLYTL--------------...RMSESTS.V--T...EHLNTL----------------------------------
B8YLY5_MEDTR/73-192.KRRLYTL--------------...RMGESTS.V--T...DHINTL----------------------------------
Q25A78_ORYSA/77-175........--------------......NDGS.V--M...DHLSVF----------------------------------
Q53QA4_ORYSJ/75-188.KMKLFTL--------------...KMKEEDS.V--I...THMAEF----------------------------------
Q94LG0_ORYSJ/79-192.KMKLFSH--------------...KLQESGS.V--L...NHISVF----------------------------------
Q01MJ3_ORYSA/27-111.KQKLFLH--------------...KLQDDGS.V--M...DHLSAF----------------------------------
A5BQQ6_VITVI/23-136.KQRLYSH--------------...RMKEGMS.L--E...DHLIVF----------------------------------
A5BPL2_VITVI/25-141.KQQLYXH--------------...HMIEGMS.L--E...DHLTVF----------------------------------
Q9SJT2_ARATH/93-212.KQKLYSF--------------...KMSENLS.I--E...GNIDEF----------------------------------
Q9SH77_ARATH/93-212.KQKLYSF--------------...KMSENLS.V--E...GNIDEF----------------------------------
Q9FFM0_ARATH/98-215.KQRLYGY--------------...KMSENMT.M--E...ENVNDF----------------------------------
Q9LS18_ARATH/107-224.KRKLFEF--------------...KMSENKA.V--E...ENIEDF----------------------------------
Q9ZQE4_ARATH/102-211.QLKFYTY--------------...KMTDSRS.I--D...GNVDDF----------------------------------
Q9LJS6_ARATH/105-202.HLKFYTY--------------...KMTDSKS.I--D...GNVDDF----------------------------------
O81903_ARATH/103-220.QLRLYSF--------------...KMVDNLS.I--D...QNTDEF----------------------------------
Q9SHR5_ARATH/101-218.QLKLYSF--------------...KMVSTMT.I--D...QNVDEF----------------------------------
Q9LVY5_ARATH/105-222.QLKFYSF--------------...RMMTSKT.I--D...QNVDDF----------------------------------
Q02900_ARATH/97-214.QLKFYSF--------------...KMNDSKS.I--N...ENVNEF----------------------------------
O82196_ARATH/63-180.QLKVYNY--------------...RMQDSKT.L--E...ENVDEF----------------------------------
Q9ZPU5_ARATH/68-187.QLSFYTF--------------...KMQENKK.I--D...ENIDDF----------------------------------
Q1KUM3_9ROSI/117-234.MQRVSGF--------------...RMDSSRT.I--E...ENLDIF----------------------------------
A5AR03_VITVI/133-256.KRRKKSA--------------KRDKMHEGKS.I--D...ENIDEF----------------------------------
A5ARG5_VITVI/22-139.KQKFFGF--------------...KMHEKKS.I--D...EIIDEF----------------------------------
Q9M3C1_ARATH/26-145.KHKFTSF--------------...KMVENKS.I--E...ENLDTS----------------------------------
A5AJF1_VITVI/465-574.KIKLYTF--------------...KMTTGMS.I--E...EHLDHF----------------------------------
A5BLL6_VITVI/78-195.KIKLYTF--------------...KMIPGMS.I--E...EHLDHF----------------------------------
A5BYU4_VITVI/59-176.KVKLYTF--------------...KMTSSMS.I--E...EHLDHF----------------------------------
A5BPE6_VITVI/78-195.KRQLHTL--------------...KMSEGMQ.V--R...DHLNNF----------------------------------
Q18L98_CITSI/80-198.KKRLYTF--------------...SMREGVT.I--Q...DHIDTF----------------------------------
A5B6C0_VITVI/29-150.KNWLYTL--------------...QMKEGTSTI--K...NHLDEF----------------------------------
A5AYK3_VITVI/32-152.KKRLHTL--------------...QMKESMS.I--K...DHFNEF----------------------------------
A5B8Q0_VITVI/529-644.KKRLHTL--------------...HMKKFMS.I--K...DLLDEF----------------------------------
Q2AA73_ASPOF/71-191.KQRLYTL--------------...WMSEGTP.I--K...SHIGEF----------------------------------
A5AM57_VITVI/98-215.KEHLYGF--------------...KIEESKP.I--D...DALDEF----------------------------------
A5C6J6_VITVI/77-184.KKRSYSL--------------............--.....HIDEF----------------------------------
A5AQ94_VITVI/78-195.KERLYGF--------------...KMQEDRS.I--A...DNLDDF----------------------------------
A5AKU3_VITVI/615-723........--------------...FKQEDRS.I--A...DKLDHF----------------------------------
C6GFP7_FRAAN/52-171.KEQLFGL--------------...KMEEGDD.L--N...DHICKF----------------------------------
A5C6L3_VITVI/78-195.MKKLFNL--------------...KMAENAS.V--A...QHLNEF----------------------------------
A5BCL0_VITVI/55-172.MKKLFHL--------------...KIEEDFS.V--A...TLLNEF----------------------------------
A5AL15_VITVI/39-145.MNKLFHL--------------...NMREGVS.V--A...TRLNEF----------------------------------
B9NKT0_POPTR/77-196.IKDLVNL--------------...KYRDSED.A--S...VHINVF----------------------------------
Q6RZV5_MUSAC/23-145DLLGLVNL--------------...KFKDGDN.I--V...KHISLF----------------------------------
Q9ZRJ0_TOBAC/76-193.LTKLMQV--------------...KYVEGTT.V--A...DHLNEI----------------------------------
Q5MG99_IPOBA/76-193.LKQMMNI--------------...RYREGTL.I--N...DHVNDF----------------------------------
A5AJF5_VITVI/76-192.IKKMISL--------------...KYQDETT.M--T...DHLNTF----------------------------------
A5BEP3_VITVI/54-180.IKKMISL--------------...KYQDGTP.M--T...DHLNTF----------------------------------
B3N452_DROER/17-137.YKTLLGL--------------...KVEDGQN.V--S...SHLNAF----------------------------------
B4N7F3_DROWI/52-172.YNELLSL--------------...RMTDGQE.M--P...SYINGF----------------------------------
B6V6Z8_DROME/78-198.YQKLSRL--------------...RMLEGDN.V--V...QYVNKF----------------------------------
B4NQE5_DROWI/78-198.LKRVALS--------------...RVCEGSD.A--R...HHINDF----------------------------------
Q45W64_PHACH/80-192.VRRLQKY--------------...EMSEGAD.M--E...DELRKL----------------------------------
Q5JMV2_ORYSJ/12-126.RCKWIQT--------------...RIESD...L--R...KHMDVF----------------------------------
A5CA63_VITVI/149-269.RQQVTYL--------------...RKEDDKT.I--G...EHIRTF----------------------------------
Q8W5F6_ORYSJ/80-197.MEQFHDY--------------...KMADNHS.V--V...EQAHEI----------------------------------
Q8LN71_ORYSJ/50-167.MEQFYDY--------------...KMVDDRS.V--V...EQAHEI----------------------------------
B7ZXP2_MAIZE/242-358.MEQLYDY--------------...KMVENRS.V--V...EQAHEF----------------------------------
Q10LP7_ORYSJ/115-232.VEKYHDF--------------...KMTNGKS.V--V...EQTQEL----------------------------------
A5BQ76_VITVI/63-180.VGKFLDY--------------...KMVDSKT.V--T...SQVQEL----------------------------------
Q0KIN7_SOLDE/84-201.ASRFFRF--------------...QMVDNKS.V--V...DQAQDF----------------------------------
B9GJ95_POPTR/36-153.ILKFDGY--------------...KKHQNQT.M--R...QYFIIM----------------------------------
B9GJ02_POPTR/48-165.TLKFDGY--------------...KKCQNQT.M--R...QHLTVM----------------------------------
Q7Y173_ORYSJ/18-135.IKRLTSM--------------...RYNYKDG.V--R...KHIMQM----------------------------------
A5B4U1_VITVI/192-309.IMKFTSL--------------...KLTAIRG.V--H...EHIMEM----------------------------------
Q2R404_ORYSJ/102-219.VNEMIT.--------------...SHYDGKSGI--R...KHILEM----------------------------------
A5BQ76_VITVI/411-528.LREILTS--------------...KMEEGTQ.V--R...THVLKM----------------------------------
Q0KIL6_SOLDE/90-207.MRTLMNT--------------...KMVEGTP.V--R...DHVLKM----------------------------------
Q9SZS9_ARATH/2-131VILILVGL--------------GIFSLPSTNK.T--S...SMPMDL----------------------------------
B9SXB7_RICCO/3-127VILILLAL--------------GILSVPSNSG..--.......DKA----------------------------------

PF03732

Q9XX53_CAEEL/210-308REQQLRQC-----------------VQKEKEN-V--E---SFFERV----------------------------------
PEG10_MOUSE/174-267AKRKIRRL-----------------RQ.GPGP-V--V---DYSNAF----------------------------------
Q9AUY8_ARATH/31-127LESNFLDL-----------------VQ.GRRT-V--R---EYEEEF----------------------------------
Q9FWC7_ORYSJ/155-249KMSALDTL-----------------TQ..TGT-V--T---EYKQQF----------------------------------
Q9FE41_ORYSJ/775-871SIVELSQV-----------------RQWRDEA-I--D---DYVIRF----------------------------------
Q9LP90_ARATH/163-253SQS.LFCI-----------------KQ..TGS-V--A---EYVQRF----------------------------------
Q9LMV1_ARATH/257-344SNADLWSI-----------------SQGAKES-L--R---SFVDRF----------------------------------
Q9ARZ4_ORYSJ/100-192TQQHLLGI-----------------RQRPGES-I--R---EYMRRF----------------------------------
Q9FYC9_ARATH/102-194SIAKLKLL-----------------QE..TEG-I--E---VYHARF----------------------------------
Q9SK57_ARATH/214-310LECAYLDL-----------------VQ.GNRT-V--R---EYDEEF----------------------------------
Q9FRJ2_ORYSJ/81-182LETEFRSI-----------------NQ.GDMT-I--T---QYTAKL----------------------------------
Q9AV68_ORYSJ/351-443TQFDLYNI-----------------VQKSGES-L--R---DYIRRF----------------------------------
Q9AYB5_ORYSJ/567-664KKKEFRSL-----------------TQ.GSRS-V--T---EYLHEF----------------------------------
O23529_ARATH/90-186LRTQIKQL-----------------KK.GTKT-I--D---EYVLSH----------------------------------
O82608_ARATH/272-360SDADLWSL-----------------SQQPNEP-L--R---DFLAKF----------------------------------
Q9AYC2_ORYSJ/729-826KKREFRAL-----------------HQ.GNRT-V--T---EYLHEF----------------------------------
Q9FGL3_ARATH/131-241LTQQIWSL-----------------QQ.GNMS-L--S---DYYTTL----------------------------------
Q9SQW9_ARATH/264-354AVDHLLNV-----------------RQ..TGT-V--E---EYRERF----------------------------------
Q9LNM2_ARATH/83-178SDADLWSL-----------------SQQPNEP-L--R---DFLANQ----------------------------------
Q9AYB6_ORYSJ/694-791KKREFREL-----------------KQ.GNRS-V--M---EYLHEF----------------------------------
Q9XE67_SORBI/155-252KVEEFRNI-----------------SQ.GTQK-V--Q---EYATRF----------------------------------
O49369_ARATH/139-231IAK.LTQL-----------------QE..TEG-I--E---EYHARF----------------------------------
Q9ZPF9_ARATH/97-196LHQRLRNL-----------------VQ.GNRT-V--E---EYFKEM----------------------------------
Q9XII7_ARATH/126-236TQE.IQDF-----------------RQ.GTLS-L--S---EYYTRL----------------------------------
Q9SIM3_ARATH/131-240TQE.IQDL-----------------RQ.GTMS-L--S---EYYTLL----------------------------------
Q9MA68_ARATH/89-183LRNEISGF-----------------NQKNSES-F--A---EAWERF----------------------------------
Q9M225_ARATH/186-282MEVRFLEL-----------------TL.VERS-V--W---EYDREF----------------------------------
Q96467_HORVU/82-176LRNDIMNF-----------------KQLDHEH-V--A---QAWERM----------------------------------
Q9AXC5_ANTHI/295-388VRERILEL-----------------IQ.WSNS-V--C---EYESKF----------------------------------
Q9M0T9_ARATH/89-183LRNEISGF-----------------SQKTGES-F--C---EAWERF----------------------------------
Q9SY43_ARATH/188-284MEARFLEL-----------------TQ.GVRS-V--R---EYDRKF----------------------------------
Q9C7H8_ARATH/150-242MAE.LKKL-----------------QE..TDG-I--V---EYHQQF----------------------------------
Q9ZNW4_SORBI/210-302TSTDLFQC-----------------RQNQGEA-L--R---EYFQRF----------------------------------
Q9SUN0_ARATH/223-313SSSDLWSM-----------------TQENGET-L--N---DYLGRF----------------------------------
Q9M252_ARATH/163-260LEDDFEEL-----------------RQ.DTKK-V--R---ENEREL----------------------------------
O93283_TAKRU/149-242AASRLLAL-----------------QQ.GSRS-V--A---EYTLEF----------------------------------
Q9ZQQ3_ARATH/198-290SDTDLWNL-----------------SQGPNET-L--R---AFITKF----------------------------------
Q9ATX2_MAIZE/179-271TAQALFQC-----------------TQDHEEY-L--Q---AYVRRF----------------------------------
O81471_ARATH/148-242LRNKLSTF-----------------TQGPAEA-F--K---AAWVRF----------------------------------
Q9FW76_ORYSJ/181-275LIRQWIHI-----------------TQ..TSS-V--A---DYVDRF----------------------------------
Q9SKF2_ARATH/107-197LRNEISSF-----------------TQRSNES-F--C---EAWERF----------------------------------
Q9SYE8_ARATH/131-230LHQRLRNL-----------------VQ.GSKT-V--E---EYFLEM----------------------------------
Q98SV9_TAKRU/117-207AASQIRSL-----------------RQ.GSSS-V--A---DY...F----------------------------------
Q9SJP0_ARATH/291-382SNVDLWTM-----------------AQTAKES-L--R---SFIGRF----------------------------------
Q9XE85_SORBI/114-212KQEEFRSL-----------------RM.GSMT-V--A---EYHDTF----------------------------------
Q9ZS84_SOLLC/150-247ARDKLKRL-----------------RQ..TGS-V--R---EYIKEF----------------------------------
O48967_MAIZE/245-337VEAHLHAV-----------------RQEPRET-L--R---MFISRF----------------------------------
Q9LZG5_ARATH/148-244LEMKFLRL-----------------QQ.GTKT-V--R---KYEKEF----------------------------------
Q9SX87_ARATH/132-224PISELKQL-----------------KE..TNG-I--E---EYHKKF----------------------------------
Q9LQH2_ARATH/476-575LHNRLRNL-----------------VQ.GNKS-V--E---EYYKEM----------------------------------
Q9FZN9_ARATH/121-215LRNDISGF-----------------TQTNNET-F--C---EAWERF----------------------------------
Q9SLQ0_ORYSI/194-290LLHKLQQL-----------------RQ.GNKS-V--E---EYYQAL----------------------------------
Q9UVC2_PASFU/52-153AVRVIQHL-----------------TQ..KTS-T--A---EYAAKF----------------------------------
Q9ZPG6_ARATH/97-191LRNEISGF-----------------TQKNNET-F--F---EASERF----------------------------------
Q9ZUK1_ARATH/211-302TEAHLWNF-----------------SQSADEP-L--R---TY....----------------------------------
Q9FWB1_ARATH/104-198MRNEISSF-----------------QQTGTKS-F--H---EAWERF----------------------------------
Q9HFY8_COLGL/148-252AERDLSNL-----------------RQ..NKS-A--T---LYAAEF----------------------------------

PF03564

O17518_CAEEL/85-228FIRLLGALEGEPKTLATKYQI.TSENYAKAVEAL--KNKYTNSEST----------------------------------
A7SE42_NEMVE/491-638FNYLRSLLVGPARGAVAGFAL.TAANYQSAIDLL--KRRYGQTEKI----------------------------------
Q17051_9BILA/155-293LNYLLSLLEGPAATVAQGYAM.SESSFDLVVTAL--KSNYGNPAVI----------------------------------
Q23992_DROME/160-308FNYLKSALKGEARNVVTHLLLGSGENYEATWEFL--TKRYENKRNI----------------------------------
O16669_CAEEL/141-284FYYLKSALQGNAARMIQHLPL.TAANYPVARKLL--KERFDNTTIL----------------------------------
A7XDH0_DROAN/157-302YHYLKSFLVDEAASLVRHLPI.SETAYDNAWERL--NERYDRPRQI----------------------------------
Q4JS97_ANOGA/133-280LQYLLSALKGDAAHQFEHMQI.TADNYYVTWEAL--LKRYDNSKVL----------------------------------
Q4EAY5_9RICK/161-306FHYLKSLLTDEAANLIAHLPI.TDSAYETAVSRL--NERYDRPRHI----------------------------------

PF14893

MOAP1_HUMAN/1-327TAETSHALVPKEIPGKGGIWRVIFKPPDPDNT-F..L---SRLNEF.LAGEGMTV..GELSRALGHENGSLDPEQGMI.P
D3ZGB3_RAT/1-321ADNLNQSLIPQQIPNNRGSWSVIFLPPVPEVE-S..Q---DT.FSFPAQAHGQAL..EGASGGVGVSVQ.........LR
PNM6B_HUMAN/1-320DREVNYALVPREIPGTGGPWNVVFVPRCSGEE-FLGL---GRVFHF.PEQEGQMV..ESVAGALGVGLRRVC........
PNML1_PONAB/1-365GEGVNLSTIPREFPGRGGVWRVVCRDPTQDAE-F..L---KNLNEF.LDAEGRTW..EDVVRLLQLNHPTLSQNQHQPPE
PNML1_MOUSE/1-364SEGVNLSSIPREFPGRGGVWRVVCRDPTQDDD-F..L---KNLNEF.LDGEGRTW..EDMVRLLKLNPNPPLPNSNQPPP
D2GZV4_AILME/1-326TGAVDYAAIPREMPGKGGVWKVVFKPPTSDAE-F..L---ERLHLF.LAREGWTV..QDVARVLGFQNPAPTPGPDM...
D2I1P4_AILME/1-328AQYLNRSLIPQQIPGKGGPWPVVFLPQAPDSE-S..Q---DR.PDFPAEPQRQ....AGAAGEAGAASEEGAVGVSGVID
Q5BJV6_RAT/1-329TVETGSALVPKEIPAKGGVWRVIFKPPDADSD-F..L---CRLNEF.LKGEGMTM..GELTRVLGNRNDPLCLDQNVMIP
F1PEY7_CANFA/1-297AQYLNRSLIPRQIAGKGGPWPVVFLPQAPDSD-S..Q---EKMEEYSVKRELQVWQEQEVRRVLGSVSMAGAAGEAGTAG
PNMA3_HUMAN/1-328AQDIDYALLPREIPGKGGPWEVIVKPRNSDGE-F..L---NRLNRF.LEEERRTV..SDMNRVLGSDTNCSAPRVTIS.P
PNMA5_MOUSE/1-324PEVVDYTMMPTHIPAEGGAWEVVVKPRSPDDE-F..M---NKLIYF.LRDEGRRI..VDVAKALGFSTVPTGKI......
PN6BL_HUMAN/1-327AEYLNRSLIPHQIPGNGGPWKVIFLPQVPVIE-F...---QDMPSFPAQPQGQ.....AVAKAAGAAGEAGAVGEAGGTN
PNMA5_HUMAN/1-323ADTVNYTTLPSHIPGKGGSWEVVVKPRNPDDE-F..L---SRLNYF.LKDEGRSM..TDVARALGCCSLPAESL......

PF14244

A5AE14_VITVI/10-125-----------------------........EL-----------------------------------------------
A5AFL1_VITVI/24-172-----------------------FLFYDTAHEI-----------------------------------------------
A5AL35_VITVI/26-142-----------------------..........-----------------------------------------------
A5APA9_VITVI/42-180-----------------------FIRFPTTKLV-----------------------------------------------
A5AR29_VITVI/23-171-----------------------FLSFDTAKEI-----------------------------------------------
A5ARJ9_VITVI/24-165-----------------------FLFYKTAKEI-----------------------------------------------
A5ATA8_VITVI/24-171-----------------------FIRFPTAKQV-----------------------------------------------
A5AW26_VITVI/23-156-----------------------FLFQSTAKDI-----------------------------------------------
A5AXC5_VITVI/8-148-----------------------LAKYEIAKQV-----------------------------------------------
A5AZ64_VITVI/47-175-----------------------VIYYATAH..-----------------------------------------------
A5AZK9_VITVI/143-291-----------------------FLFLSTAKDI-----------------------------------------------
A5B0N9_VITVI/37-186-----------------------YLRLPTTQEI-----------------------------------------------
A5B3L9_VITVI/16-147-----------------------YMFLPTAKQV-----------------------------------------------
A5B8L2_VITVI/15-147-----------------------........EA-----------------------------------------------
A5BAZ3_VITVI/31-163-----------------------..........-----------------------------------------------
A5BCQ9_VITVI/83-209-----------------------...HQKSGQI-----------------------------------------------
A5BG06_VITVI/43-189-----------------------FIRFPTAKQV-----------------------------------------------
A5BJC0_VITVI/21-165-----------------------CMFLATAKDI-----------------------------------------------
A5BKK0_VITVI/191-331-----------------------FICFPTTKQV-----------------------------------------------
A5BM32_VITVI/27-149-----------------------..........-----------------------------------------------
A5BN45_VITVI/28-176-----------------------FLLYGTTKEI-----------------------------------------------
A5BNR5_VITVI/308-456-----------------------IIHAKTAREV-----------------------------------------------
A5BP26_VITVI/33-181-----------------------LLYFDTAVGI-----------------------------------------------
A5BQW4_VITVI/215-363-----------------------YLFLPTTKYF-----------------------------------------------
A5BSG2_VITVI/5-152-----------------------FLXCGTAKEV-----------------------------------------------
A5BT41_VITVI/40-187-----------------------FIRFSMAKAV-----------------------------------------------
A5BVQ3_VITVI/17-164-----------------------FIXFPTAKQV-----------------------------------------------
A5BWZ5_VITVI/42-189-----------------------FIRFPTAKQV-----------------------------------------------
A5BXA9_VITVI/396-529-----------------------..........-----------------------------------------------
A5C3H8_VITVI/42-155-----------------------..........-----------------------------------------------
A5C4L4_VITVI/24-140-----------------------VIYYSIA...-----------------------------------------------
A5C4S3_VITVI/27-177-----------------------ILYHETTIEI-----------------------------------------------
A5C9I0_VITVI/13-150-----------------------LMYIAIAAKI-----------------------------------------------
B9SLN1_RICCO/35-176-----------------------VIYYATAYEV-----------------------------------------------
O22175_ARATH/27-174-----------------------VGFVSEASQL-----------------------------------------------
O23588_ARATH/73-209-----------------------........EM-----------------------------------------------
Q0PY40_SOLLC/17-166-----------------------IVYATNSCSV-----------------------------------------------
Q2HT49_MEDTR/20-168-----------------------IVFHDTALSA-----------------------------------------------
Q2HU07_MEDTR/24-172-----------------------IVFHEYAIDV-----------------------------------------------
Q6L4J8_SOLDE/13-160-----------------------ISYMETVKEL-----------------------------------------------
Q9FIC5_ARATH/29-177-----------------------MSHLDDSHDM-----------------------------------------------
Q9LGZ8_ARATH/19-166-----------------------VAFVSDAKDL-----------------------------------------------
Q9M0P5_ARATH/20-169-----------------------LLFMSTAESI-----------------------------------------------
Q9XIM3_ARATH/23-161-----------------------ILRMNDASDI-----------------------------------------------
Q9ZPU4_ARATH/37-185-----------------------VTFISDAHLL-----------------------------------------------

PF13961

Q5AT23_EMENI/319-345-------------------------------.C-----------------------------------------------
Q5AT23_EMENI/515-541-------------------------------.V-----------------------------------------------
A0EVF5_MAIZE/104-132-------------------------------SI-----------------------------------------------
A0EVG6_MAIZE/136-164-------------------------------RL-----------------------------------------------
A0MEB8_ARATH/13-39-------------------------------.V-----------------------------------------------
A2I5F8_BETVU/19-47-------------------------------QV-----------------------------------------------
A2Q2M0_MEDTR/28-56-------------------------------KI-----------------------------------------------
A2Q5V3_MEDTR/14-42-------------------------------KT-----------------------------------------------
A2XQ14_ORYSI/37-63-------------------------------.V-----------------------------------------------
A5ACV7_VITVI/14-40-------------------------------.L-----------------------------------------------
A5ACV9_VITVI/13-39-------------------------------.V-----------------------------------------------
A5ADA3_VITVI/15-41-------------------------------.L-----------------------------------------------
A5AE45_VITVI/21-49-------------------------------DX-----------------------------------------------
A5AFP3_VITVI/14-39-------------------------------.Y-----------------------------------------------
A5AGS2_VITVI/15-41-------------------------------.L-----------------------------------------------
A5AHH2_VITVI/133-159-------------------------------.L-----------------------------------------------
A5AHJ1_VITVI/21-49-------------------------------DV-----------------------------------------------
A5AKW8_VITVI/13-39-------------------------------.L-----------------------------------------------
A5AMT2_VITVI/33-58-------------------------------.Y-----------------------------------------------
A5ANP1_VITVI/21-49-------------------------------DL-----------------------------------------------
A5ANX8_VITVI/14-40-------------------------------.L-----------------------------------------------
A5AVP1_VITVI/15-40-------------------------------.Y-----------------------------------------------
A5AWN8_VITVI/13-39-------------------------------.V-----------------------------------------------
A5AX99_VITVI/16-44-------------------------------KV-----------------------------------------------
A5B0F2_VITVI/14-40-------------------------------.L-----------------------------------------------
A5B1X3_VITVI/15-41-------------------------------.M-----------------------------------------------
A5B3E3_VITVI/45-71-------------------------------.L-----------------------------------------------
A5B612_VITVI/21-49-------------------------------DL-----------------------------------------------
A5B8H9_VITVI/78-103-------------------------------.Y-----------------------------------------------
A5BB46_VITVI/210-235-------------------------------.Y-----------------------------------------------
A5BD08_VITVI/13-39-------------------------------.L-----------------------------------------------
A5BLB0_VITVI/214-240-------------------------------.V-----------------------------------------------
A5BLE1_VITVI/15-41-------------------------------.L-----------------------------------------------
A5BM96_VITVI/21-49-------------------------------DV-----------------------------------------------
A5BNN7_VITVI/10-36-------------------------------.L-----------------------------------------------
A5BP60_VITVI/21-49-------------------------------DI-----------------------------------------------
A5BQA9_VITVI/73-99-------------------------------.L-----------------------------------------------
A5BRW6_VITVI/14-40-------------------------------.F-----------------------------------------------
A5BSL1_VITVI/14-39-------------------------------.Y-----------------------------------------------
A5BTH8_VITVI/21-49-------------------------------DL-----------------------------------------------
A5BV67_VITVI/23-49-------------------------------.L-----------------------------------------------
A5BVS1_VITVI/10-36-------------------------------.C-----------------------------------------------
A5BXS1_VITVI/15-41-------------------------------.L-----------------------------------------------
A5C0Q9_VITVI/16-42-------------------------------.L-----------------------------------------------
A5C3F9_VITVI/15-41-------------------------------.L-----------------------------------------------
A5C3G4_VITVI/99-125-------------------------------.L-----------------------------------------------
A5C753_VITVI/21-49-------------------------------DL-----------------------------------------------
A6FWP0_9RHOB/12-38-------------------------------.L-----------------------------------------------
A6YTD9_CUCME/15-41-------------------------------.L-----------------------------------------------
A9RSN5_PHYPA/14-40-------------------------------.L-----------------------------------------------
B0D6P6_LACBS/11-37-------------------------------.L-----------------------------------------------
B0WQU4_CULQU/10-36-------------------------------.L-----------------------------------------------
B0WWB7_CULQU/11-37-------------------------------.L-----------------------------------------------
B4K1A4_DROGR/12-38-------------------------------.L-----------------------------------------------
B4LA17_DROMO/10-36-------------------------------.L-----------------------------------------------
B4LAF9_DROMO/10-36-------------------------------.L-----------------------------------------------
B4LE08_DROVI/13-41-------------------------------.M-----------------------------------------------
B4MX54_DROWI/10-37-------------------------------.C-----------------------------------------------
B4NQE5_DROWI/11-37-------------------------------.L-----------------------------------------------
B4NQR9_DROWI/10-36-------------------------------.L-----------------------------------------------
B6HA76_PENCW/19-46-------------------------------.V-----------------------------------------------
B6QCF0_PENMQ/36-62-------------------------------.C-----------------------------------------------
B6REL1_9BRAS/2-28-------------------------------.V-----------------------------------------------
B6REL9_9BRAS/23-49-------------------------------.V-----------------------------------------------
B6REM4_9BRAS/12-38-------------------------------.L-----------------------------------------------
B6TPM7_MAIZE/33-59-------------------------------.L-----------------------------------------------
B6V6Z8_DROME/10-36-------------------------------.L-----------------------------------------------
B8BDZ6_ORYSI/26-52-------------------------------.V-----------------------------------------------
B9FWJ4_ORYSJ/161-187-------------------------------.L-----------------------------------------------
B9GKP2_POPTR/14-40-------------------------------.L-----------------------------------------------
B9GSJ3_POPTR/134-160-------------------------------.L-----------------------------------------------
B9HE40_POPTR/16-42-------------------------------.L-----------------------------------------------
B9HFW3_POPTR/15-41-------------------------------.L-----------------------------------------------
B9HGE2_POPTR/14-40-------------------------------.L-----------------------------------------------
B9HKW4_POPTR/29-55-------------------------------.L-----------------------------------------------
B9HL08_POPTR/16-42-------------------------------.L-----------------------------------------------
B9HPY3_POPTR/20-46-------------------------------.L-----------------------------------------------
B9I2Y2_POPTR/15-41-------------------------------.L-----------------------------------------------
B9I573_POPTR/13-39-------------------------------.L-----------------------------------------------
B9IBK8_POPTR/14-40-------------------------------.F-----------------------------------------------
B9IK76_POPTR/27-53-------------------------------.L-----------------------------------------------
B9MXT9_POPTR/15-41-------------------------------.L-----------------------------------------------
B9NB79_POPTR/15-41-------------------------------.I-----------------------------------------------
B9NCJ4_POPTR/14-40-------------------------------.F-----------------------------------------------
B9NDW0_POPTR/15-41-------------------------------.L-----------------------------------------------
B9NL03_POPTR/15-41-------------------------------.Q-----------------------------------------------
B9P6D1_POPTR/13-39-------------------------------.L-----------------------------------------------
B9P7V6_POPTR/11-37-------------------------------.L-----------------------------------------------
B9PAL4_POPTR/13-39-------------------------------.C-----------------------------------------------
B9PCS7_POPTR/28-54-------------------------------.V-----------------------------------------------
B9RBX9_RICCO/17-43-------------------------------.L-----------------------------------------------
B9RC68_RICCO/10-37-------------------------------.L-----------------------------------------------
B9S5P6_RICCO/16-42-------------------------------.I-----------------------------------------------
C0JJI1_SOYBN/14-40-------------------------------.A-----------------------------------------------
C1IJC5_HORVU/51-77-------------------------------.M-----------------------------------------------
C5GBD9_AJEDR/188-215-------------------------------.C-----------------------------------------------
C5WNA6_SORBI/166-192-------------------------------.L-----------------------------------------------
C5XQM0_SORBI/42-68-------------------------------.L-----------------------------------------------
C5XUK3_SORBI/137-163-------------------------------.L-----------------------------------------------
C5Z583_SORBI/42-68-------------------------------.W-----------------------------------------------
C6JSM1_SORBI/23-49-------------------------------.V-----------------------------------------------
C7J1L6_ORYSJ/181-207-------------------------------.M-----------------------------------------------
C7J1U3_ORYSJ/16-44-------------------------------KI-----------------------------------------------
C7J5A1_ORYSJ/49-75-------------------------------.L-----------------------------------------------
C7J6P4_ORYSJ/14-42-------------------------------DI-----------------------------------------------
C7J7K5_ORYSJ/83-109-------------------------------.L-----------------------------------------------
D0NBZ2_PHYIT/18-44-------------------------------.L-----------------------------------------------
D0P386_PHYIT/3-29-------------------------------.L-----------------------------------------------
D0P4P1_PHYIT/16-42-------------------------------.V-----------------------------------------------
D0RLQ9_PHYIT/21-47-------------------------------.L-----------------------------------------------
D2A4C7_TRICA/13-39-------------------------------.L-----------------------------------------------
D2A543_TRICA/14-40-------------------------------.V-----------------------------------------------
D3IVE4_9POAL/157-183-------------------------------.V-----------------------------------------------
D3IVI1_9POAL/13-41-------------------------------AI-----------------------------------------------
Q01L11_ORYSA/14-42-------------------------------HI-----------------------------------------------
Q01L55_ORYSA/55-83-------------------------------SI-----------------------------------------------
Q01LI0_ORYSA/9-35-------------------------------.L-----------------------------------------------
Q01MW9_ORYSA/19-45-------------------------------.L-----------------------------------------------
Q0DA14_ORYSJ/28-54-------------------------------.L-----------------------------------------------
Q0IZT5_ORYSJ/33-59-------------------------------.I-----------------------------------------------
Q0J5Y3_ORYSJ/54-80-------------------------------.I-----------------------------------------------
Q0WNA8_ARATH/12-38-------------------------------.L-----------------------------------------------
Q10B81_ORYSJ/39-67-------------------------------SI-----------------------------------------------
Q10F54_ORYSJ/861-887-------------------------------.M-----------------------------------------------
Q10PG0_ORYSJ/12-40-------------------------------NV-----------------------------------------------
Q16S15_AEDAE/12-38-------------------------------.L-----------------------------------------------
Q25AF6_ORYSA/59-85-------------------------------.L-----------------------------------------------
Q2QS45_ORYSJ/14-42-------------------------------NI-----------------------------------------------
Q2R0F7_ORYSJ/478-504-------------------------------.L-----------------------------------------------
Q4ABY7_BRACM/25-51-------------------------------.V-----------------------------------------------
Q6K285_ORYSJ/82-108-------------------------------.L-----------------------------------------------
Q6L3N8_SOLDE/17-43-------------------------------.L-----------------------------------------------
Q6XMP8_AEDAL/16-42-------------------------------.V-----------------------------------------------
Q710T7_POPDE/16-42-------------------------------.M-----------------------------------------------
Q75M81_ORYSJ/48-74-------------------------------.L-----------------------------------------------
Q7G5Z8_ORYSJ/52-78-------------------------------.V-----------------------------------------------
Q7G756_ORYSJ/12-40-------------------------------DI-----------------------------------------------
Q7XH44_ORYSJ/104-130-------------------------------.L-----------------------------------------------
Q7XKY1_ORYSJ/53-79-------------------------------.L-----------------------------------------------
Q7XMT1_ORYSJ/56-82-------------------------------.L-----------------------------------------------
Q84Q85_ORYSJ/36-62-------------------------------.Q-----------------------------------------------
Q84VH6_SOYBN/16-44-------------------------------RT-----------------------------------------------
Q850T3_ORYSJ/12-40-------------------------------DV-----------------------------------------------
Q8H6I0_MAIZE/134-162-------------------------------SI-----------------------------------------------
Q8H6I4_MAIZE/130-158-------------------------------SL-----------------------------------------------
Q8H6W2_CICAR/19-47-------------------------------DI-----------------------------------------------
Q967L5_AEDAE/11-37-------------------------------.L-----------------------------------------------
Q9C7Y1_ARATH/12-37-------------------------------.W-----------------------------------------------
Q9LE43_ARATH/25-51-------------------------------.T-----------------------------------------------
Q9LH44_ARATH/12-38-------------------------------.L-----------------------------------------------
Q9LIG4_ARATH/14-40-------------------------------.L-----------------------------------------------
Q9LJ55_ARATH/26-52-------------------------------.V-----------------------------------------------
Q9LJD1_ARATH/12-38-------------------------------.L-----------------------------------------------
Q9LJD2_ARATH/12-38-------------------------------.L-----------------------------------------------
Q9LNQ5_ARATH/22-48-------------------------------.V-----------------------------------------------
Q9M1C6_ARATH/15-40-------------------------------.L-----------------------------------------------
Q9MAR7_ARATH/25-51-------------------------------.A-----------------------------------------------
Q9SKV6_ARATH/22-48-------------------------------.M-----------------------------------------------
Q9XEB1_ARATH/10-36-------------------------------.L-----------------------------------------------
Q9XEB1_ARATH/348-376-------------------------------DA-----------------------------------------------
Q9ZQE9_ARATH/12-38-------------------------------.L-----------------------------------------------
Q9ZTG6_TOBAC/19-47-------------------------------RL-----------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204-----------------------IGLLNELEVL-G---------------------------------------------
A5BQ76_VITVI/412-525-----------------------MSLLNDMEVL-G---------------------------------------------
A5AHT8_VITVI/92-205-----------------------SNLVTRLKAL-K---------------------------------------------
B8BH64_ORYSI/219-332-----------------------SHLASKLKAL-K---------------------------------------------
A5BI38_VITVI/288-401-----------------------RNIAAQLKTL-E---------------------------------------------
B9GJ95_POPTR/37-150-----------------------SNLINELRGA-E---------------------------------------------
A5ANU6_VITVI/96-209-----------------------QVIVNKLKVL-K---------------------------------------------
A5B8Q0_VITVI/530-643-----------------------NKTIMDLRNI-D---------------------------------------------
A5AQ94_VITVI/79-192-----------------------AKIVLEMSNI-G---------------------------------------------
Q18L98_CITSI/81-195-----------------------NKIILDLEGV-E---------------------------------------------
Q1KUM3_9ROSI/118-231-----------------------QKLLSDLHSL-N---------------------------------------------
Q7XTM9_ORYSJ/78-191-----------------------KEIVADLESM-E---------------------------------------------
Q01M93_ORYSA/78-191-----------------------KKIVADLVSM-E---------------------------------------------
A5AS33_VITVI/79-194-----------------------NTITNQLSSV-K---------------------------------------------
Q2AA06_ASPOF/860-974-----------------------TKLLSNLANV-D---------------------------------------------
Q6XMP8_AEDAL/82-196-----------------------EDLIRQLRMA-G---------------------------------------------
D2A543_TRICA/77-191-----------------------EETIRELKSV-G---------------------------------------------
Q9U6V8_DROWI/75-189-----------------------DELISELLAA-G---------------------------------------------
A5BIJ4_VITVI/84-197-----------------------KHMADELALI-G---------------------------------------------
Q0ZCD8_POPTR/118-230-----------------------KTLADEIALI-D---------------------------------------------
A5B6L3_VITVI/126-238-----------------------KNYCDLLATA-G---------------------------------------------
A5BYA6_VITVI/62-174-----------------------RVCVDSLASI-G---------------------------------------------
A5BK17_VITVI/103-215-----------------------RNVVDLLALV-G---------------------------------------------
A5CAE5_VITVI/64-176-----------------------KHISDSLAAI-G---------------------------------------------
A5BJ70_VITVI/81-193-----------------------KTISDNLAAV-G---------------------------------------------
A5BFR8_VITVI/115-227-----------------------KGAADNLAAI-G---------------------------------------------
Q9SV56_ARATH/103-217-----------------------KQICDQLDSI-G---------------------------------------------
Q9SSB1_ARATH/101-216-----------------------KHICDQLASV-G---------------------------------------------
D1GEF6_BRARP/107-222-----------------------KTICDQLTSI-G---------------------------------------------
C0SQ79_PORYE/115-228-----------------------KGIRDDLATA-G---------------------------------------------
A5B3I2_VITVI/89-207-----------------------LTIANKMKAN-G---------------------------------------------
A5B8H9_VITVI/153-271-----------------------LTIANKMRVH-G---------------------------------------------
A5BGM4_VITVI/89-207-----------------------MAIINKMRIH-G---------------------------------------------
Q9M1C6_ARATH/91-209-----------------------LTVVNKMKTN-G---------------------------------------------
A5BYF7_VITVI/162-280-----------------------LTIANKMKAH-E---------------------------------------------
A5BY31_VITVI/28-146-----------------------MSVSNKMRFH-G---------------------------------------------
A5BFQ9_VITVI/28-146-----------------------MTMANKMQIY-G---------------------------------------------
Q9C7Y1_ARATH/87-205-----------------------MEITNDMRNL-G---------------------------------------------
A5AMT2_VITVI/80-198-----------------------IAIVNKIRIH-G---------------------------------------------
Q2QXM6_ORYSJ/85-203-----------------------IEIVNQMRLY-G---------------------------------------------
Q6L3N8_SOLDE/84-202-----------------------SAIVNRMRSY-G---------------------------------------------
A6YTD9_CUCME/91-209-----------------------LVIVNSLRSN-G---------------------------------------------
Q9M2D1_ARATH/89-207-----------------------LTVTNNLKRN-G---------------------------------------------
B9IN28_POPTR/105-223-----------------------FATVNNLKSL-G---------------------------------------------
A5BLB0_VITVI/283-400-----------------------MELVNQMKSY-G---------------------------------------------
Q9LH44_ARATH/87-205-----------------------INLSNQLRVH-G---------------------------------------------
Q9ZQE9_ARATH/91-209-----------------------IVLEIQLTYH-G---------------------------------------------
A5B9M8_VITVI/90-208-----------------------MDVVNQMRLL-G---------------------------------------------
A5BRD1_VITVI/91-209-----------------------LSIVNKVRLL-D---------------------------------------------
A5B779_VITVI/91-209-----------------------LGIVNKVRLL-G---------------------------------------------
Q9SEL2_VITVI/89-207-----------------------LSIANKVRLL-G---------------------------------------------
A5BFD6_VITVI/89-207-----------------------LTIANKVRLL-G---------------------------------------------
B9N6H7_POPTR/91-209-----------------------LGIVNRVKLL-G---------------------------------------------
B9HFW3_POPTR/91-209-----------------------LGIVNKVRLL-G---------------------------------------------
B9P8C1_POPTR/91-209-----------------------LNIASRISLL-G---------------------------------------------
A5BRW6_VITVI/90-208-----------------------SLIVNKIRSL-G---------------------------------------------
Q6L3X6_SOLDE/202-320-----------------------SLIVNNIRLL-G---------------------------------------------
A5ACV7_VITVI/90-208-----------------------MEVVNKIRLL-G---------------------------------------------
Q6L3Y5_SOLDE/89-207-----------------------MKIFNQIRLL-G---------------------------------------------
Q60EG1_ORYSJ/85-201-----------------------TTMGVRHSAL-G---------------------------------------------
C6JSM1_SORBI/92-210-----------------------TGMSVRYGNL-G---------------------------------------------
B6TPM7_MAIZE/94-212-----------------------SGMAARYAGL-G---------------------------------------------
Q9SHT5_ARATH/47-166-----------------------SEISTKSESL-G---------------------------------------------
Q9ZUF2_ARATH/41-160-----------------------SEISTKSTSL-G---------------------------------------------
Q4ABY7_BRACM/83-202-----------------------SEISAKSASL-G---------------------------------------------
Q9LQK3_ARATH/80-199-----------------------SEISTKSAAL-G---------------------------------------------
Q9SKV6_ARATH/80-199-----------------------AELATRSDAL-G---------------------------------------------
Q9LE43_ARATH/83-202-----------------------AEIASKSAAL-G---------------------------------------------
B6REL9_9BRAS/81-200-----------------------SELASKSAAL-G---------------------------------------------
B6REL1_9BRAS/60-179-----------------------FEISSRSAAL-G---------------------------------------------
B9PCS7_POPTR/86-204-----------------------TALVGEIRSL-G---------------------------------------------
Q7F814_ORYSJ/95-213-----------------------TTIVNEIRSL-G---------------------------------------------
B8BA29_ORYSI/100-218-----------------------TALVGRIREL-G---------------------------------------------
D3IVE4_9POAL/219-337-----------------------SSLYNQIVSL-G---------------------------------------------
Q7X7K3_ORYSJ/176-294-----------------------GVLANNLRTL-G---------------------------------------------
Q0J5Y3_ORYSJ/115-233-----------------------TGLANNLRTL-G---------------------------------------------
Q7XH44_ORYSJ/165-269-----------------------FGIANSIRTL-G---------------------------------------------
Q2QYR6_ORYSJ/52-170-----------------------TGLANELRML-G---------------------------------------------
Q5TKD7_ORYSJ/109-227-----------------------HALVIDIRDM-G---------------------------------------------
Q7XTU6_ORYSJ/114-232-----------------------TAVVADIRDM-G---------------------------------------------
Q8LMZ0_ORYSJ/135-253-----------------------NAIVNNLRML-G---------------------------------------------
Q7G5Z8_ORYSJ/110-228-----------------------TGLVNNIHTL-G---------------------------------------------
Q53P77_ORYSJ/86-204-----------------------NTVVTQLSTL-G---------------------------------------------
Q2QZL2_ORYSJ/49-167-----------------------TTIVNQLATL-G---------------------------------------------
Q7XWP2_ORYSJ/116-231-----------------------TSVVNQLATH-G---------------------------------------------
Q10C26_ORYSJ/22-139-----------------------NNLVTTLVTL-G---------------------------------------------
Q7XUD9_ORYSJ/115-233-----------------------NGLVTNLATL-G---------------------------------------------
Q25AF6_ORYSA/117-235-----------------------TSLVSQLGTL-G---------------------------------------------
C1IJC5_HORVU/114-232-----------------------TGMCARLGEL-G---------------------------------------------
C5Y7F6_SORBI/35-153-----------------------SKLASDLRGL-G---------------------------------------------
Q94I41_ORYSJ/94-212-----------------------NGLVASLREL-G---------------------------------------------
C5XUK3_SORBI/218-337-----------------------STLHQQLVIH-G---------------------------------------------
C5XQM0_SORBI/100-219-----------------------ATLKQQMILH-G---------------------------------------------
Q9AUM6_ORYSJ/569-688-----------------------NSLQQRLAQL-G---------------------------------------------
Q2QWI2_ORYSJ/47-166-----------------------NTLLQKMVQY-G---------------------------------------------
C5Z583_SORBI/100-218-----------------------QSLATQLATY-R---------------------------------------------
C5WNA6_SORBI/224-342-----------------------SSLISKLGSY-G---------------------------------------------
D3IVP8_9POAL/630-749-----------------------NKIISDLQSV-D---------------------------------------------
D3IVT7_9POAL/58-177-----------------------SKILHDLHAM-D---------------------------------------------
D3IVI1_9POAL/86-205-----------------------HKILSNLRAV-G---------------------------------------------
Q10PG0_ORYSJ/85-204-----------------------GEIISKLRSV-G---------------------------------------------
D3IVI3_9POAL/99-218-----------------------NKVINQMRVV-D---------------------------------------------
Q5H9X1_ORYSJ/112-231-----------------------SKIVNEIKGL-G---------------------------------------------
Q10NE5_ORYSJ/129-248-----------------------MILVNKIKGL-G---------------------------------------------
C5WYF6_SORBI/63-181-----------------------MVLVGKIRGY-G---------------------------------------------
Q8S467_MAIZE/138-257-----------------------KTLVNQVRNL-G---------------------------------------------
Q8H6I4_MAIZE/204-323-----------------------MVLVNKIRVL-G---------------------------------------------
Q33BC8_ORYSJ/86-203-----------------------NVIVNDLKGL-G---------------------------------------------
A2Q5V3_MEDTR/101-218-----------------------LDIANSFDSL-G---------------------------------------------
O65147_SOYBN/76-194-----------------------LEIANACTAL-G---------------------------------------------
A5BZ48_VITVI/103-221-----------------------MDIVNSSFNL-G---------------------------------------------
Q9XEB1_ARATH/433-551-----------------------SSITQEAVVL-G---------------------------------------------
Q9FG84_ARATH/101-219-----------------------SAIASEAHNL-G---------------------------------------------
Q9ZV83_ARATH/82-200-----------------------SALANEAEVM-G---------------------------------------------
A2I5F8_BETVU/104-223-----------------------TNIINELASL-G---------------------------------------------
A5BW11_VITVI/73-191-----------------------TDIVNGLEAL-G---------------------------------------------
Q1S5J6_MEDTR/118-236-----------------------QTLVSGLQIL-K---------------------------------------------
Q9FJT0_ARATH/33-146-----------------------LELVFRMKSC-G---------------------------------------------
Q9LJD1_ARATH/93-210-----------------------LEILERLGRA-K---------------------------------------------
Q9LJD1_ARATH/509-622-----------------------IEIVEQLRRF-K---------------------------------------------
Q9LJC8_ARATH/91-202-----------------------EEITERFEVL-G---------------------------------------------
Q9LJC9_ARATH/91-203-----------------------EKIIEEFFVW-G---------------------------------------------
A9TSN8_PHYPA/23-136-----------------------YDFINDMREI-N---------------------------------------------

PF14227

A5BY76_VITVI/104-226-----------------------TDIVDGLKVL.G---------------------------------------------
A5B9Z7_VITVI/12-134-----------------------TEIVNXLEAL.G---------------------------------------------
A5BSC1_VITVI/688-789-----------------------TEIVNGLEAL.G---------------------------------------------
A5BWL8_VITVI/342-448-----------------------TDLVNGLEAL.G---------------------------------------------
A5BLR1_VITVI/94-215-----------------------TDIVNRLEAL.E---------------------------------------------
A5BLB0_VITVI/282-404-----------------------MELVNQMKSY.G---------------------------------------------
Q9LJC9_ARATH/90-212-----------------------EKIIEEFFVW.G---------------------------------------------
Q5AT23_EMENI/392-511-----------------------NAELEDISSG.K---------------------------------------------
D3IVP8_9POAL/629-752-----------------------NKIISDLQSV.D---------------------------------------------
COPIA_DROME/74-192-----------------------DELISELLAA.G---------------------------------------------
D2A543_TRICA/76-194-----------------------EETIRELKSV.G---------------------------------------------
O96968_BOMMO/78-193-----------------------DMLIRQLEET.G---------------------------------------------
Q6XMP8_AEDAL/81-199-----------------------EDLIRQLRMA.G---------------------------------------------
B0X5G3_CULQU/101-222-----------------------TAMHNRLEVA.D---------------------------------------------
Q967L5_AEDAE/76-197-----------------------DDLFDRLDAA.G---------------------------------------------
Q8WRX6_ANOGA/74-195-----------------------DELFSSLMNA.G---------------------------------------------
B2CN78_DAPPU/42-160-----------------------ETMASMLSDV.E---------------------------------------------
A9RF54_PHYPA/34-146-----------------------KALANQLAIV.D---------------------------------------------
Q8H023_ORYSJ/210-330-----------------------NQLVVDLSKL.D---------------------------------------------
Q7XSZ1_ORYSJ/103-219-----------------------NQLVVDLSKL.D---------------------------------------------
Q7XLX2_ORYSJ/160-253-----------------------NQLVTDLVKM.D---------------------------------------------
A5BPQ9_VITVI/512-624-----------------------NHIISDLKRI.D---------------------------------------------
A5B864_VITVI/32-156-----------------------NHIISDLKQI.D---------------------------------------------
Q9AU17_SOLCI/79-196-----------------------NGLITQLANL.G---------------------------------------------
B1N668_SOLLC/75-192-----------------------NTLLLELRNI.D---------------------------------------------
Q2AA06_ASPOF/859-977-----------------------TKLLSNLANV.D---------------------------------------------
B9NAJ4_POPTR/37-154-----------------------NKMIADLKNL.D---------------------------------------------
Q69FA7_PHAVU/58-175-----------------------NQLVAYLLNL.D---------------------------------------------
Q6BCY1_IPOBA/74-193-----------------------NTLFSQLTSL.S---------------------------------------------
B8YLY5_MEDTR/73-192-----------------------NTLFSQLTAS.D---------------------------------------------
Q25A78_ORYSA/77-175-----------------------KEIVADLESM.E---------------------------------------------
Q53QA4_ORYSJ/75-188-----------------------KKIVADLVSM.E---------------------------------------------
Q94LG0_ORYSJ/79-192-----------------------KEIVVDLVSI.E---------------------------------------------
Q01MJ3_ORYSA/27-111-----------------------KEIVADLESM.E---------------------------------------------
A5BQQ6_VITVI/23-136-----------------------KGIVSNLETM.E---------------------------------------------
A5BPL2_VITVI/25-141-----------------------KEIGSDLETM.E---------------------------------------------
Q9SJT2_ARATH/93-212-----------------------LRIIADLENT.N---------------------------------------------
Q9SH77_ARATH/93-212-----------------------LQIITDLENM.N---------------------------------------------
Q9FFM0_ARATH/98-215-----------------------FKLISDLENV.K---------------------------------------------
Q9LS18_ARATH/107-224-----------------------FRIVEDLEKL.D---------------------------------------------
Q9ZQE4_ARATH/102-211-----------------------LKLVTDLNNI.G---------------------------------------------
Q9LJS6_ARATH/105-202-----------------------LKLVTDLNNI.G---------------------------------------------
O81903_ARATH/103-220-----------------------LRIVAELGSL.Q---------------------------------------------
Q9SHR5_ARATH/101-218-----------------------LRIVAELGSL.E---------------------------------------------
Q9LVY5_ARATH/105-222-----------------------LRIVAELGSL.D---------------------------------------------
Q02900_ARATH/97-214-----------------------LKIVAELSSL.E---------------------------------------------
O82196_ARATH/63-180-----------------------QKMISDLNNL.Q---------------------------------------------
Q9ZPU5_ARATH/68-187-----------------------LKIVADLNHL.Q---------------------------------------------
Q1KUM3_9ROSI/117-234-----------------------QKLLSDLHSL.N---------------------------------------------
A5AR03_VITVI/133-256-----------------------TKLVLDLESL.G---------------------------------------------
A5ARG5_VITVI/22-139-----------------------TKLVVDLESL.C---------------------------------------------
Q9M3C1_ARATH/26-145-----------------------LKLVADLASL.D---------------------------------------------
A5AJF1_VITVI/465-574-----------------------NKIILDLENI.D---------------------------------------------
A5BLL6_VITVI/78-195-----------------------NKIILDLENI.D---------------------------------------------
A5BYU4_VITVI/59-176-----------------------NKIILDLKNI.D---------------------------------------------
A5BPE6_VITVI/78-195-----------------------NRIILDLNGV.G---------------------------------------------
Q18L98_CITSI/80-198-----------------------NKIILDLEGVEN---------------------------------------------
A5B6C0_VITVI/29-150-----------------------NKTIMDLRNI.D---------------------------------------------
A5AYK3_VITVI/32-152-----------------------NKTIXDLRNI.D---------------------------------------------
A5B8Q0_VITVI/529-644-----------------------NKTIMDLRNI.D---------------------------------------------
Q2AA73_ASPOF/71-191-----------------------NSVITYLSKI.D---------------------------------------------
A5AM57_VITVI/98-215-----------------------NKLVLDLESL.D---------------------------------------------
A5C6J6_VITVI/77-184-----------------------NKVILDLENI.D---------------------------------------------
A5AQ94_VITVI/78-195-----------------------AKIVLEMSNI.G---------------------------------------------
A5AKU3_VITVI/615-723-----------------------AKIVLEMSNI.G---------------------------------------------
C6GFP7_FRAAN/52-171-----------------------QNCIANLEKV.G---------------------------------------------
A5C6L3_VITVI/78-195-----------------------NTITNQLSSV.E---------------------------------------------
A5BCL0_VITVI/55-172-----------------------NMIVNQLSSV.E---------------------------------------------
A5AL15_VITVI/39-145-----------------------NMIVXQLSSI.E---------------------------------------------
B9NKT0_POPTR/77-196-----------------------QGFLNQLSLM.N---------------------------------------------
Q6RZV5_MUSAC/23-145-----------------------QSLANKLVAM.K---------------------------------------------
Q9ZRJ0_TOBAC/76-193-----------------------QGIVDQLSGM.G---------------------------------------------
Q5MG99_IPOBA/76-193-----------------------QGVLDQLSGM.G---------------------------------------------
A5AJF5_VITVI/76-192-----------------------QGIINQLVRM.N---------------------------------------------
A5BEP3_VITVI/54-180-----------------------QGIINQLVGM.N---------------------------------------------
B3N452_DROER/17-137-----------------------NEVLDQLSSV.G---------------------------------------------
B4N7F3_DROWI/52-172-----------------------SDVLDQLAGA.G---------------------------------------------
B6V6Z8_DROME/78-198-----------------------AETVNKLAEM.D---------------------------------------------
B4NQE5_DROWI/78-198-----------------------FDAVKKLKEI.G---------------------------------------------
Q45W64_PHACH/80-192-----------------------TEMRAEAAEA.G---------------------------------------------
Q5JMV2_ORYSJ/12-126-----------------------DQLVKDLNYL.D---------------------------------------------
A5CA63_VITVI/149-269-----------------------KSLCDSLAAI.A---------------------------------------------
Q8W5F6_ORYSJ/80-197-----------------------QTMAKKLELL.K---------------------------------------------
Q8LN71_ORYSJ/50-167-----------------------QMLAKELENN.N---------------------------------------------
B7ZXP2_MAIZE/242-358-----------------------QALAKELELF.P---------------------------------------------
Q10LP7_ORYSJ/115-232-----------------------QLLVGELNHS.K---------------------------------------------
A5BQ76_VITVI/63-180-----------------------QIILHELHAE.K---------------------------------------------
Q0KIN7_SOLDE/84-201-----------------------IMIVGELRSE.E---------------------------------------------
B9GJ95_POPTR/36-153-----------------------SNLINELRGA.E---------------------------------------------
B9GJ02_POPTR/48-165-----------------------SNMISELKGV.E---------------------------------------------
Q7Y173_ORYSJ/18-135-----------------------GAMNGELKSM.D---------------------------------------------
A5B4U1_VITVI/192-309-----------------------RDIVAQLKKL.E---------------------------------------------
Q2R404_ORYSJ/102-219-----------------------THMANQLRSM.D---------------------------------------------
A5BQ76_VITVI/411-528-----------------------MSLLNDMEVL.G---------------------------------------------
Q0KIL6_SOLDE/90-207-----------------------IGLLNELEVL.G---------------------------------------------
Q9SZS9_ARATH/2-131-----------------------TTIVQTIQERES---------------------------------------------
B9SXB7_RICCO/3-127-----------------------HDLTTIVHNKEQ---------------------------------------------

PF03732

Q9XX53_CAEEL/210-308----------------------.EKLVAMTSSGKS---------------------------------------------
PEG10_MOUSE/174-267----------------------.QMIAQDLD....---------------------------------------------
Q9AUY8_ARATH/31-127----------------------.NKLRRYVGR...---------------------------------------------
Q9FWC7_ORYSJ/155-249----------------------.DYLVYQIR....---------------------------------------------
Q9FE41_ORYSJ/775-871----------------------RNSFVCLARE...---------------------------------------------
Q9LP90_ARATH/163-253----------------------.EDLSSQVG....---------------------------------------------
Q9LMV1_ARATH/257-344----------------------.KLVVTNIT....---------------------------------------------
Q9ARZ4_ORYSJ/100-192----------------------.SQARCQVQD...---------------------------------------------
Q9FYC9_ARATH/102-194----------------------.ESICTRVK....---------------------------------------------
Q9SK57_ARATH/214-310----------------------.NRLRRYVGR...---------------------------------------------
Q9FRJ2_ORYSJ/81-182----------------------.KQLADGLRDI.N---------------------------------------------
Q9AV68_ORYSJ/351-443----------------------.SEQRNKISD...---------------------------------------------
Q9AYB5_ORYSJ/567-664----------------------.NRLARYAPE...---------------------------------------------
O23529_ARATH/90-186----------------------.TTLLDQLAIL.G---------------------------------------------
O82608_ARATH/272-360----------------------.RSTLAKVE....---------------------------------------------
Q9AYC2_ORYSJ/729-826----------------------.NRLARYAPE...---------------------------------------------
Q9FGL3_ARATH/131-241----------------------.KTLWDDLDGA.S---------------------------------------------
Q9SQW9_ARATH/264-354----------------------.EELTVDLPH...---------------------------------------------
Q9LNM2_ARATH/83-178----------------------.RRGGSLCSEE.S---------------------------------------------
Q9AYB6_ORYSJ/694-791----------------------.NNLARYAPE...---------------------------------------------
Q9XE67_SORBI/155-252----------------------.TRTMRYAPD...---------------------------------------------
O49369_ARATH/139-231----------------------.ELISTRLN....---------------------------------------------
Q9ZPF9_ARATH/97-196----------------------.ETLMLRAD....---------------------------------------------
Q9XII7_ARATH/126-236----------------------.KTLWDQLD....---------------------------------------------
Q9SIM3_ARATH/131-240----------------------.KTLWDQLD....---------------------------------------------
Q9MA68_ARATH/89-183----------------------.KRYSTQCPH...---------------------------------------------
Q9M225_ARATH/186-282----------------------.NRVLVYAGW...---------------------------------------------
Q96467_HORVU/82-176----------------------.KLMIRNCPA...---------------------------------------------
Q9AXC5_ANTHI/295-388----------------------.TRLIQYAPH...---------------------------------------------
Q9M0T9_ARATH/89-183----------------------.KGYTNQCPH...---------------------------------------------
Q9SY43_ARATH/188-284----------------------.NRLLVYAGR...---------------------------------------------
Q9C7H8_ARATH/150-242----------------------.ELIKVRLN....---------------------------------------------
Q9ZNW4_SORBI/210-302----------------------.VQTKARAP....---------------------------------------------
Q9SUN0_ARATH/223-313----------------------.KEILSSYHHG..---------------------------------------------
Q9M252_ARATH/163-260----------------------.SHLSRFSVR...---------------------------------------------
O93283_TAKRU/149-242----------------------.RILAAESR....---------------------------------------------
Q9ZQQ3_ARATH/198-290----------------------.KYVLSKLSR...---------------------------------------------
Q9ATX2_MAIZE/179-271----------------------.LRLRAQAPT...---------------------------------------------
O81471_ARATH/148-242----------------------.KEYQRDCPH...---------------------------------------------
Q9FW76_ORYSJ/181-275----------------------.DSIMHQLMAY.G---------------------------------------------
Q9SKF2_ARATH/107-197----------------------.KGYKMQCPH...---------------------------------------------
Q9SYE8_ARATH/131-230----------------------.ETLMLRAD....---------------------------------------------
Q98SV9_TAKRU/117-207----------------------.RILAARSG....---------------------------------------------
Q9SJP0_ARATH/291-382----------------------.KEIVTSVA....---------------------------------------------
Q9XE85_SORBI/114-212----------------------.EQLARYAPN...---------------------------------------------
Q9ZS84_SOLLC/150-247----------------------.TSVMLDIQN...---------------------------------------------
O48967_MAIZE/245-337----------------------.TKVQGTIPR...---------------------------------------------
Q9LZG5_ARATH/148-244----------------------.HSLERFERR...---------------------------------------------
Q9SX87_ARATH/132-224----------------------.ELLRARVN....---------------------------------------------
Q9LQH2_ARATH/476-575----------------------.ETLMLRAD....---------------------------------------------
Q9FZN9_ARATH/121-215----------------------.KGYQTQCPH...---------------------------------------------
Q9SLQ0_ORYSI/194-290----------------------.QIGMLRCG....---------------------------------------------
Q9UVC2_PASFU/52-153----------------------.QEYAQLTD....---------------------------------------------
Q9ZPG6_ARATH/97-191----------------------.KSYTTYCPH...---------------------------------------------
Q9ZUK1_ARATH/211-302----------------------..IYRVQGNH...---------------------------------------------
Q9FWB1_ARATH/104-198----------------------.KVYYRECPH...---------------------------------------------
Q9HFY8_COLGL/148-252----------------------.RRLAARLD....---------------------------------------------

PF03564

O17518_CAEEL/85-228----------------------INSLNEKLLKEK.---------------------------------------------
A7SE42_NEMVE/491-638----------------------KRAHINEIMKVRG---------------------------------------------
Q17051_9BILA/155-293----------------------IASLHTELQNLPS---------------------------------------------
Q23992_DROME/160-308----------------------FSDHMNRLMDMPN---------------------------------------------
O16669_CAEEL/141-284----------------------RHLLLRKLQEIQP---------------------------------------------
A7XDH0_DROAN/157-302----------------------IHNLLDTFMELPS---------------------------------------------
Q4JS97_ANOGA/133-280----------------------KREYFKAFYSLEK---------------------------------------------
Q4EAY5_9RICK/161-306----------------------VFSLLEQFTRLPE---------------------------------------------

PF14893

MOAP1_HUMAN/1-327EM..WAPMLAQAL.EALQPAL.QCLKYKKLRVFSG....RESPEPGEEEFGRWMFHTTQMIKA.................
D3ZGB3_RAT/1-321QACQWTREWSQAL....QPIL.ENMAYQELRHFTG....MEEPGCGGQSFESWLDHANDMLYL.................
PNM6B_HUMAN/1-320....WLRSIGQAV....QPWV.EAVRYQSLGVFSG....RDQPAPGEESFEVWLDHTTEMLHV.................
PNML1_PONAB/1-365N...WAEALGVLLGAVVQ.....IIFCMDAEIRSR.EEARAQEAAEFEEMAAWALAAGKKVKKEPGLAAEVGSALKAETP
PNML1_MOUSE/1-364N...WAEALGLLLGAVVQ.....VIFYMDAAIRSRDEEARAEEAAEAELMEAWASTARKRVKKEPGLGVEVGSAFKMEDR
D2GZV4_AILME/1-326....PAEMLNYILDSVIQPLV.ESIWYKKLTLFSG....RDIPGPGEETFDPWLEHTNEVIEE.................
D2I1P4_AILME/1-328EGGSWTQQRNQAQ....QPVP.ENMAYGELRTFSG....LEEPDQEEESFESWLDHANDMLYT.................
Q5BJV6_RAT/1-329EI..RAPMLAQALDEALKPTL.QYLRYKKLSVFSG....RDPPGPGEEEFESWMFHTSQVMKT.................
F1PEY7_CANFA/1-297E.....EGAAGAVDEAWQPVP.EDAAYGELRTFSG....MEDP..DQESFEVWLEHANDMLFM.................
PNMA3_HUMAN/1-328EFWTWAQTLGAAV....QPLL.EQMLYRELRVFSG....NTISIPGALAFDAWLEHTTEMLQM.................
PNMA5_MOUSE/1-324....ELKNLDQDKPKGLKSLCNNSTCYKKLKVFSG....SPFPGPGEESFETWLEEVTELMQL.................
PN6BL_HUMAN/1-327VTKAWVQPWRCTL....QPVL.ENRAYRELRPFSR....REQPGCEEESFESWVEHAKDMLQL.................
PNMA5_HUMAN/1-323....DAEVMPQVRSPPLEPPK.ESMWYRKLKVFSG....TASPSPGEETFEDWLEQVTEIMPI.................

PF14244

A5AE14_VITVI/10-125--W----------------------------EEIK..QQFSIGN...GPRVQQ....LKS..YLVNCK.QE.GQGIIVYY
A5AFL1_VITVI/24-172--W----------------------------MAAK..ETYSBSDN..TADLLD....IKG..APHDLR.QG.EMIVTHYY
A5AL35_VITVI/26-142--.----------------------------..........................LKT..SIAKCE.QSKSMSVTTYY
A5APA9_VITVI/42-180--W----------------------------DAIX..XTYFDGNB..TSQVYE....LRR..RVTRLQ.QG.NGSLEKFY
A5AR29_VITVI/23-171--W----------------------------DTAK..DTFSDKEN..TSEIIQ....IEG..ILHDLR.QG.NLTVTEYF
A5ARJ9_VITVI/24-165--W----------------------------DAAK..EMFSDNEN..AVEVFE....IKS..QLRVTA.RG.PQCDPI..
A5ATA8_VITVI/24-171--W----------------------------DAIA..TTYFDGSD..ATQVYE....LRR..RVARLR.QG.SGSLEKYY
A5AW26_VITVI/23-156--W----------------------------DVVV..KXHSXKGN..ATRIFE....LKH..AIHETKQR..DLDVLSYF
A5AXC5_VITVI/8-148--W----------------------------DHLALXLIFEQCNK...........................RMSTQEFY
A5AZ64_VITVI/47-175--.----------------------------.....................E....IQR..EIAYHR.QE.QLSISVYY
A5AZK9_VITVI/143-291--W----------------------------DAVV..KAYSKKGN..ATRIFE....LKG..AIHETK.QQ.GLNVLSYF
A5B0N9_VITVI/37-186--W----------------------------SALS..KAFYDGSD.....ELQVFTLNKKAFTTKQSG.....RSLSEYY
A5B3L9_VITVI/16-147--W----------------------------DVVV..ETYSDMEN..SAQVFEITNKIQE....................
A5B8L2_VITVI/15-147--L----------------------------QQAV..MSTSDPDN..TSGVVL....ITK..GLKLSS.TN.TNSIA...
A5BAZ3_VITVI/31-163--.----------------------------..AK..ETYSSSEN..TSELFQ....VES..ALHDFR.QG.EQSVTQYY
A5BCQ9_VITVI/83-209--C----------------------------ENV.....FRQGN...DSRIYQ....IKR..DIVEHR.QG.QQSISVYY
A5BG06_VITVI/43-189--W----------------------------DAIA..TTYFNGSD..ATQVYE....LRR..KNAANG.TG.KAAIASTE
A5BJC0_VITVI/21-165--W----------------------------DAIQ..QT.VIKTK.....CLEDAVVLKDFIEQDRVY............
A5BKK0_VITVI/191-331--W----------------------------DSIA..TTYFDGSD..TSQVYD....LRR..RVTRMW.QG.GESIEKYY
A5BM32_VITVI/27-149--.----------------------------EELK..IRYLRSD...GPRVFS....LEK..SLSSIS.QN.SKSITEYF
A5BN45_VITVI/28-176--W----------------------------DAAR..ETYSNFEN..TSEIFE....IEA..TLHDLR.QG.DLSVTQYF
A5BNR5_VITVI/308-456--W----------------------------VDLR..DQFSQKN...APAVFQ....IQK..SIATMS.QG.TMTVAAYF
A5BP26_VITVI/33-181--W----------------------------NDLR..DRFCQSN...GPRIFQ....IKK..HLIALS.QG.SLDVSTYY
A5BQW4_VITVI/215-363--W----------------------------ANVT..LP...........LLQRDSDFMENSNDCACH.EKKEKNDQVYM
A5BSG2_VITVI/5-152--W----------------------------DXVK..RSYLDVFH..SSQVHE....LMK..KSFQSH.QG.XCPLTKYY
A5BT41_VITVI/40-187--W----------------------------DNIV..ITYFDGTD..TSQVYD....LKR..RVTRLK.QE.GGSIKTYY
A5BVQ3_VITVI/17-164--W----------------------------DSAA..ITYFDGTD..TSQVYD....LRR..RVTRMK.QA.GGSIEKYY
A5BWZ5_VITVI/42-189--W----------------------------DSVA..ITYFDGTD..TSQVYD....LRR..WVTHDRLDK.TGSDVLQI
A5BXA9_VITVI/396-529--.----------------------------.......TYGQIVE..QKRLFKFFLGLNR..ELDDVR..D.RIMGIKPL
A5C3H8_VITVI/42-155--.----------------------------..........KGCN..TSQVYE....LRQ..HVTRLQ.QG.SGSLEKFY
A5C4L4_VITVI/24-140--.----------------------------.......................................Q.QLFISAYY
A5C4S3_VITVI/27-177--W----------------------------NDLY..ERFHQGS...GPRIFE....IKQ..KILAHT.QG.LAYVNTYY
A5C9I0_VITVI/13-150--W----------------------------IDLL..DRFRHSN...APRGCS....ASV..NAH.............IG
B9SLN1_RICCO/35-176--W----------------------------EVLC..DDSHKSQILLHSPLPT....VRQ..SYASIT.QA.EKQIQISY
O22175_ARATH/27-174--W----------------------------ENLR..RRFSVGN...GVRKTL....LKD..EIAACT.QD.GQPVLAYY
O23588_ARATH/73-209--W----------------------------NDLF..SRFRVSN...LPRKYQ....LEQ..SIHTLK.QG.NLDLSTYY
Q0PY40_SOLLC/17-166--W----------------------------NDLK..ERFDKVN...RVRIYQ....LHR..DITTLS.QG.TDSVSHYF
Q2HT49_MEDTR/20-168--W----------------------------DDLK..ECFSKVD...RVRVLS....LRS..TINNLK.QG.TKSVLDYF
Q2HU07_MEDTR/24-172--W----------------------------IELQ..ERFSKVD...RIRVAS....LRS..SINNLK.QG.DKSVLDYF
Q6L4J8_SOLDE/13-160--W----------------------------EDLR..ERFSVAS...GRNLLA....IHVGCTCGAEK.KL.TQEREKEK
Q9FIC5_ARATH/29-177--W----------------------------THIQ..KRFGVKN...GQRIQR....LKT..ELATCR.QK.GTPIETYY
Q9LGZ8_ARATH/19-166--W----------------------------DSLK..QRFSNGN...GVRKQL....LKD..EILACK.QD.GQSVLVYY
Q9M0P5_ARATH/20-169--W----------------------------KNLL..SRFKQDD...APRVFE....IEQ..RLGSLQ.QG.SMDVSTYY
Q9XIM3_ARATH/23-161--W----------------------------RDLN..SRFNMTN...LPRTYN....LTQ..EIQDLR.QG.TLSLSEYY
Q9ZPU4_ARATH/37-185--W----------------------------KDLK..QRFSVGN...KVRIHQ....IRA..QLSSCR.QD.GQAVIEYY

PF13961

Q5AT23_EMENI/319-345--W------------------------.---SVVE---------------------------------------------
Q5AT23_EMENI/515-541--W------------------------.---EVVE---------------------------------------------
A0EVF5_MAIZE/104-132--W------------------------.---EIVE---------------------------------------------
A0EVG6_MAIZE/136-164--W------------------------.---DVVE---------------------------------------------
A0MEB8_ARATH/13-39--W------------------------.---EIVE---------------------------------------------
A2I5F8_BETVU/19-47--W------------------------.---RVIE---------------------------------------------
A2Q2M0_MEDTR/28-56--W------------------------.---KAVL---------------------------------------------
A2Q5V3_MEDTR/14-42--W------------------------.---KAVL---------------------------------------------
A2XQ14_ORYSI/37-63--W------------------------.---AAVE---------------------------------------------
A5ACV7_VITVI/14-40--W------------------------.---QWVE---------------------------------------------
A5ACV9_VITVI/13-39--W------------------------.---EAVE---------------------------------------------
A5ADA3_VITVI/15-41--W------------------------.---EAIE---------------------------------------------
A5AE45_VITVI/21-49--W------------------------.---DIIE---------------------------------------------
A5AFP3_VITVI/14-39--W------------------------.---QVVS---------------------------------------------
A5AGS2_VITVI/15-41--W------------------------.---EVVS---------------------------------------------
A5AHH2_VITVI/133-159--W------------------------.---DLVE---------------------------------------------
A5AHJ1_VITVI/21-49--W------------------------.---DVIE---------------------------------------------
A5AKW8_VITVI/13-39--W------------------------.---EVVN---------------------------------------------
A5AMT2_VITVI/33-58--W------------------------.---TIVV---------------------------------------------
A5ANP1_VITVI/21-49--W------------------------.---DAIE---------------------------------------------
A5ANX8_VITVI/14-40--W------------------------.---EVVV---------------------------------------------
A5AVP1_VITVI/15-40--W------------------------.---GLVE---------------------------------------------
A5AWN8_VITVI/13-39--W------------------------.---EAIE---------------------------------------------
A5AX99_VITVI/16-44--W------------------------.---NAVE---------------------------------------------
A5B0F2_VITVI/14-40--W------------------------.---NVVM---------------------------------------------
A5B1X3_VITVI/15-41--W------------------------.---ESVS---------------------------------------------
A5B3E3_VITVI/45-71--W------------------------.---ELCQ---------------------------------------------
A5B612_VITVI/21-49--W------------------------.---DVIE---------------------------------------------
A5B8H9_VITVI/78-103--W------------------------.---NLIE---------------------------------------------
A5BB46_VITVI/210-235--W------------------------.---SLVE---------------------------------------------
A5BD08_VITVI/13-39--W------------------------.---ETVE---------------------------------------------
A5BLB0_VITVI/214-240--W------------------------.---DLVE---------------------------------------------
A5BLE1_VITVI/15-41--W------------------------.---EAVE---------------------------------------------
A5BM96_VITVI/21-49--W------------------------.---DIIK---------------------------------------------
A5BNN7_VITVI/10-36--W------------------------.---GHID---------------------------------------------
A5BP60_VITVI/21-49--W------------------------.---DVIK---------------------------------------------
A5BQA9_VITVI/73-99--W------------------------.---DVVS---------------------------------------------
A5BRW6_VITVI/14-40--W------------------------.---EVVA---------------------------------------------
A5BSL1_VITVI/14-39--W------------------------.---HIVE---------------------------------------------
A5BTH8_VITVI/21-49--W------------------------.---DVIE---------------------------------------------
A5BV67_VITVI/23-49--W------------------------.---SHID---------------------------------------------
A5BVS1_VITVI/10-36--L------------------------.---ETIS---------------------------------------------
A5BXS1_VITVI/15-41--W------------------------.---EAVD---------------------------------------------
A5C0Q9_VITVI/16-42--W------------------------.---EVVK---------------------------------------------
A5C3F9_VITVI/15-41--W------------------------.---NVVM---------------------------------------------
A5C3G4_VITVI/99-125--W------------------------.---DVCK---------------------------------------------
A5C753_VITVI/21-49--W------------------------.---DVIK---------------------------------------------
A6FWP0_9RHOB/12-38--W------------------------.---YVID---------------------------------------------
A6YTD9_CUCME/15-41--W------------------------.---DIVE---------------------------------------------
A9RSN5_PHYPA/14-40--W------------------------.---DVVS---------------------------------------------
B0D6P6_LACBS/11-37--W------------------------.---PMVK---------------------------------------------
B0WQU4_CULQU/10-36--W------------------------.---EVVM---------------------------------------------
B0WWB7_CULQU/11-37--W------------------------.---DVIE---------------------------------------------
B4K1A4_DROGR/12-38--W------------------------.---PIVS---------------------------------------------
B4LA17_DROMO/10-36--W------------------------.---SVVS---------------------------------------------
B4LAF9_DROMO/10-36--W------------------------.---EVVC---------------------------------------------
B4LE08_DROVI/13-41--W------------------------P---AVIS---------------------------------------------
B4MX54_DROWI/10-37--W------------------------.---SVVC---------------------------------------------
B4NQE5_DROWI/11-37--W------------------------.---QCVN---------------------------------------------
B4NQR9_DROWI/10-36--W------------------------.---NVAS---------------------------------------------
B6HA76_PENCW/19-46--W------------------------.---DVVS---------------------------------------------
B6QCF0_PENMQ/36-62--W------------------------.---DVVE---------------------------------------------
B6REL1_9BRAS/2-28--W------------------------.---KVIE---------------------------------------------
B6REL9_9BRAS/23-49--W------------------------.---ETIE---------------------------------------------
B6REM4_9BRAS/12-38--W------------------------.---TVVE---------------------------------------------
B6TPM7_MAIZE/33-59--W------------------------.---EAVS---------------------------------------------
B6V6Z8_DROME/10-36--W------------------------.---KVVC---------------------------------------------
B8BDZ6_ORYSI/26-52--W------------------------.---DAIE---------------------------------------------
B9FWJ4_ORYSJ/161-187--W------------------------.---DVLS---------------------------------------------
B9GKP2_POPTR/14-40--W------------------------.---RIVT---------------------------------------------
B9GSJ3_POPTR/134-160--W------------------------.---DIVQ---------------------------------------------
B9HE40_POPTR/16-42--W------------------------.---EVVE---------------------------------------------
B9HFW3_POPTR/15-41--W------------------------.---KAVE---------------------------------------------
B9HGE2_POPTR/14-40--W------------------------.---EIVS---------------------------------------------
B9HKW4_POPTR/29-55--W------------------------.---EAVE---------------------------------------------
B9HL08_POPTR/16-42--W------------------------.---DFIE---------------------------------------------
B9HPY3_POPTR/20-46--W------------------------.---TLVD---------------------------------------------
B9I2Y2_POPTR/15-41--W------------------------.---EAVE---------------------------------------------
B9I573_POPTR/13-39--W------------------------.---EIVE---------------------------------------------
B9IBK8_POPTR/14-40--W------------------------.---DAVE---------------------------------------------
B9IK76_POPTR/27-53--W------------------------.---KAME---------------------------------------------
B9MXT9_POPTR/15-41--W------------------------.---EAVE---------------------------------------------
B9NB79_POPTR/15-41--W------------------------.---EAVK---------------------------------------------
B9NCJ4_POPTR/14-40--W------------------------.---DAIE---------------------------------------------
B9NDW0_POPTR/15-41--W------------------------.---EVVS---------------------------------------------
B9NL03_POPTR/15-41--W------------------------.---EAVE---------------------------------------------
B9P6D1_POPTR/13-39--C------------------------.---ETVK---------------------------------------------
B9P7V6_POPTR/11-37--W------------------------.---EQLN---------------------------------------------
B9PAL4_POPTR/13-39--L------------------------.---EIVH---------------------------------------------
B9PCS7_POPTR/28-54--W------------------------.---SVIE---------------------------------------------
B9RBX9_RICCO/17-43--W------------------------.---NFVE---------------------------------------------
B9RC68_RICCO/10-37--W------------------------.---DIVE---------------------------------------------
B9S5P6_RICCO/16-42--L------------------------.---EAIN---------------------------------------------
C0JJI1_SOYBN/14-40--W------------------------.---EIVE---------------------------------------------
C1IJC5_HORVU/51-77--W------------------------.---RAIE---------------------------------------------
C5GBD9_AJEDR/188-215--W------------------------.---NIIE---------------------------------------------
C5WNA6_SORBI/166-192--W------------------------.---NAID---------------------------------------------
C5XQM0_SORBI/42-68--W------------------------.---DAVE---------------------------------------------
C5XUK3_SORBI/137-163--W------------------------.---DAIE---------------------------------------------
C5Z583_SORBI/42-68--W------------------------.---RAIE---------------------------------------------
C6JSM1_SORBI/23-49--W------------------------.---DVME---------------------------------------------
C7J1L6_ORYSJ/181-207--W------------------------.---EAVR---------------------------------------------
C7J1U3_ORYSJ/16-44--W------------------------.---WIVD---------------------------------------------
C7J5A1_ORYSJ/49-75--W------------------------.---AAIE---------------------------------------------
C7J6P4_ORYSJ/14-42--W------------------------.---RKVS---------------------------------------------
C7J7K5_ORYSJ/83-109--W------------------------.---SAIE---------------------------------------------
D0NBZ2_PHYIT/18-44--W------------------------.---QYCI---------------------------------------------
D0P386_PHYIT/3-29--W------------------------.---GIVT---------------------------------------------
D0P4P1_PHYIT/16-42--W------------------------.---SAVL---------------------------------------------
D0RLQ9_PHYIT/21-47--W------------------------.---KYCE---------------------------------------------
D2A4C7_TRICA/13-39--W------------------------.---DYTN---------------------------------------------
D2A543_TRICA/14-40--K------------------------.---RCIE---------------------------------------------
D3IVE4_9POAL/157-183--W------------------------.---GVVD---------------------------------------------
D3IVI1_9POAL/13-41--W------------------------.---RKVK---------------------------------------------
Q01L11_ORYSA/14-42--W------------------------.---SIVD---------------------------------------------
Q01L55_ORYSA/55-83--W------------------------.---KVVC---------------------------------------------
Q01LI0_ORYSA/9-35--W------------------------.---DIVD---------------------------------------------
Q01MW9_ORYSA/19-45--W------------------------.---EAVN---------------------------------------------
Q0DA14_ORYSJ/28-54--W------------------------.---DAVE---------------------------------------------
Q0IZT5_ORYSJ/33-59--W------------------------.---DAIE---------------------------------------------
Q0J5Y3_ORYSJ/54-80--W------------------------.---YAVE---------------------------------------------
Q0WNA8_ARATH/12-38--W------------------------.---DVVE---------------------------------------------
Q10B81_ORYSJ/39-67--W------------------------.---RIVE---------------------------------------------
Q10F54_ORYSJ/861-887--W------------------------.---DTVW---------------------------------------------
Q10PG0_ORYSJ/12-40--W------------------------.---NKVK---------------------------------------------
Q16S15_AEDAE/12-38--L------------------------.---HCIE---------------------------------------------
Q25AF6_ORYSA/59-85--W------------------------.---DAVE---------------------------------------------
Q2QS45_ORYSJ/14-42--W------------------------.---RKVS---------------------------------------------
Q2R0F7_ORYSJ/478-504--W------------------------.---GTVD---------------------------------------------
Q4ABY7_BRACM/25-51--W------------------------.---ETIE---------------------------------------------
Q6K285_ORYSJ/82-108--W------------------------.---HAIE---------------------------------------------
Q6L3N8_SOLDE/17-43--W------------------------.---DIVE---------------------------------------------
Q6XMP8_AEDAL/16-42--W------------------------.---DAIV---------------------------------------------
Q710T7_POPDE/16-42--W------------------------.---GYVS---------------------------------------------
Q75M81_ORYSJ/48-74--W------------------------.---EAVD---------------------------------------------
Q7G5Z8_ORYSJ/52-78--W------------------------.---DAVE---------------------------------------------
Q7G756_ORYSJ/12-40--W------------------------.---KKVS---------------------------------------------
Q7XH44_ORYSJ/104-130--W------------------------.---HAVE---------------------------------------------
Q7XKY1_ORYSJ/53-79--W------------------------.---EAVD---------------------------------------------
Q7XMT1_ORYSJ/56-82--W------------------------.---KAID---------------------------------------------
Q84Q85_ORYSJ/36-62--W------------------------.---DAVE---------------------------------------------
Q84VH6_SOYBN/16-44--W------------------------.---KAVI---------------------------------------------
Q850T3_ORYSJ/12-40--W------------------------.---QKVA---------------------------------------------
Q8H6I0_MAIZE/134-162--W------------------------.---DVVE---------------------------------------------
Q8H6I4_MAIZE/130-158--W------------------------.---EIVN---------------------------------------------
Q8H6W2_CICAR/19-47--L------------------------.---DAVE---------------------------------------------
Q967L5_AEDAE/11-37--W------------------------.---DVVV---------------------------------------------
Q9C7Y1_ARATH/12-37--W------------------------.---DIIE---------------------------------------------
Q9LE43_ARATH/25-51--W------------------------.---DVIE---------------------------------------------
Q9LH44_ARATH/12-38--W------------------------.---DVIE---------------------------------------------
Q9LIG4_ARATH/14-40--W------------------------.---YVVK---------------------------------------------
Q9LJ55_ARATH/26-52--W------------------------.---DTVE---------------------------------------------
Q9LJD1_ARATH/12-38--W------------------------.---DVVV---------------------------------------------
Q9LJD2_ARATH/12-38--W------------------------.---DVVE---------------------------------------------
Q9LNQ5_ARATH/22-48--W------------------------.---ETID---------------------------------------------
Q9M1C6_ARATH/15-40--W------------------------.---RLVE---------------------------------------------
Q9MAR7_ARATH/25-51--W------------------------.---NMID---------------------------------------------
Q9SKV6_ARATH/22-48--W------------------------.---ETIE---------------------------------------------
Q9XEB1_ARATH/10-36--W------------------------.---EIVD---------------------------------------------
Q9XEB1_ARATH/348-376--W------------------------.---FAVE---------------------------------------------
Q9ZQE9_ARATH/12-38--W------------------------.---SVVE---------------------------------------------
Q9ZTG6_TOBAC/19-47--W------------------------.---QIIK---------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204--A.EIDN-------------------D---SQVEMILQSLP.DS--FQQFCLN---YNMN..KMSL...SLAQLLNELQ
A5BQ76_VITVI/412-525--A.EVDK-------------------A---TQIEMVLNTLP.PS--FQQFRLN---YNMN..KMDF...TLSKLLNELV
A5AHT8_VITVI/92-205--L.ELSE-------------------D---ILVHLVLISLP.TQ--FSPFKIS---YNTQ..KEKW...TLNELIAQCV
B8BH64_ORYSI/219-332--L.DLSE-------------------D---LLMHLILISLP.TQ--FNQFKVS---YNCQ..KDKW...TVNKLITHCV
A5BI38_VITVI/288-401--V.EMSD-------------------S---FLVHFILNTFP.QQ--YGPFKIS---YNTH..KDKW...SINELLTMCV
B9GJ95_POPTR/37-150--H.EMTD-------------------E---QQVQVVIHSLP.SN--WEHIRVN---LTHN..DNIK...IFDDVARHVE
A5ANU6_VITVI/96-209--I.ELPE-------------------A---FQVGAIVAKLP.SS--WKGYRKR---ILHK..SEDY...SLEEIQKHLR
A5B8Q0_VITVI/530-643--I.RIDD-------------------E---DQAMTLISSLP.NS--YGHFVDT---MMYG..RDTL...SIEDVREALN
A5AQ94_VITVI/79-192--I.KVDD-------------------E---DKAVLVLKSLP.GL--YSNFKET---MKYG..RKTL...TLEEVQSALR
Q18L98_CITSI/81-195--NVKICD-------------------E---DKAFFLLSSLP.KS--YEGFVDT---MLYG..RTTL...TLEDVKASLS
Q1KUM3_9ROSI/118-231--V.KVEE-------------------E---YQAVYLLNSLP.PA--YEQLREV---LKYS..RATI...SVEEVKAAAR
Q7XTM9_ORYSJ/78-191--V.KYDE-------------------K---DLALILLCSLP.SS--YANFRDT---ILYS..RDTL...TLKEVYDALH
Q01M93_ORYSA/78-191--V.KYDD-------------------E---DLGLLLLCSLP.NS--YANFRDT---ILLS..RDEL...TLKEVYDALQ
A5AS33_VITVI/79-194--I.DFDD-------------------E---ICALIVLASLP.NI--WETMRMV---VRNSTGKEKL...KYNDIQDLIL
Q2AA06_ASPOF/860-974--E.KISD-------------------E---YKTIILLGSLPDEE--YDTFLLT---LLNG..RPSI...SYSEITNALT
Q6XMP8_AEDAL/82-196--S.KLEE-------------------S---DVCSSLALTLP.ES--YDALVTA---LENL..PENEL..TYEVMKTRLI
D2A543_TRICA/77-191--A.KLEE-------------------M---DVVCHLLLTLP.KS--FDPLVTA---LETM..EPSKL..TLDFVKGKLL
Q9U6V8_DROWI/75-189--A.KIEE-------------------M---DKISHLLITLP.SC--YDGIITA---IETL..SEENL..TLAFVKNRLL
A5BIJ4_VITVI/84-197--A.SLSE-------------------D---EILLHVLNGLS.PK--YKELGVV---MCVR..DTPI...SFEELHDKLI
Q0ZCD8_POPTR/118-230--H.PISA-------------------D---DLTFYILNGLG.PD--FREIAAP---IRAR..EKSL...TFEELHDLLV
A5B6L3_VITVI/126-238--H.KISD-------------------T---DHILAIMQGLG.DE--YESVIAV---ISSK..KSSP...SLQYVTSTLI
A5BYA6_VITVI/62-174--V.SLST-------------------K---DHVESILDGLP.SD--YESFVTS---ITLR..NDDF...SVEEIEVLLM
A5BK17_VITVI/103-215--H.KISV-------------------K---DHIBAIFEGLP.QD--YETFIIS---VNSR..LDPY...TVEEIEALLL
A5CAE5_VITVI/64-176--E.PVPE-------------------K---DQILQLLSGLG.AE--YNPIVAS---LTAR..DDDI...QLHAVHSILL
A5BJ70_VITVI/81-193--E.PVKD-------------------R---DHILQLLGGLG.PD--YNSIVAS---LTAR..EDDL...SLHSVHNILL
A5BFR8_VITVI/115-227--E.PVSE-------------------Q---DQVMNLLGGLG.SD--YNAVVTA---INIR..DDKI...SLEAIHSMLL
Q9SV56_ARATH/103-217--C.PVPE-------------------N---EKIFGVLNGLG.QE--YMLVSTM---IKGS..MDTYPM.SFEDVVFKLI
Q9SSB1_ARATH/101-216--S.PVPE-------------------K---MKIFSALNGLG.RE--YEPIKTT---IENS..VDSNPSLSLDEVASKLR
D1GEF6_BRARP/107-222--Q.PVDE-------------------R---MKIFAALLGLG.KE--YEPIKTS---IEGS..MDTQYHPSFEDVVPRLV
C0SQ79_PORYE/115-228--V.NKDE-------------------H---SFCLDILRGLP.AP--FKTIRTV---LRNS..GKLL...TLPTITNRLM
A5B3I2_VITVI/89-207--E.NKGD-------------------V---VVVEKILRSMT.PK--FDYVVCS---IEES..KDTNT.LTIDELQSSLL
A5B8H9_VITVI/153-271--Q.KMED-------------------V---VVIEKILRSMT.PK--FNCVVCS---IEES..NDLDT.LSIDVLQSSLL
A5BGM4_VITVI/89-207--E.KMED-------------------V---TVIEKILRSMT.PK--FNYVVCS---IEES..KDLDE.LSIDELQGSLL
Q9M1C6_ARATH/91-209--E.VMEQ-------------------S---TIVSKILRSLT.PK--FNYVVCS---IEES..NDLST.LSIDELHGSLL
A5BYF7_VITVI/162-280--E.RMGQ-------------------N---VIVEKILRSMX.PR--LDYVVYS---IEES..NNVDM.MTTDELXSSLL
A5BY31_VITVI/28-146--E.QMRE-------------------V---TIVEKILRSLT.DN--FNYIVCS---IEES..KDTDT.LTIDELQSSLI
A5BFQ9_VITVI/28-146--E.DMQD-------------------V---KVVEKILRSLT.EK--FNYVVCS---IEEL..KDIDV.LTIDELKSSLI
Q9C7Y1_ARATH/87-205--E.DMPD-------------------S---KVVEKILRTLV.EK--FTYVVCA---IEES..NNIKE.LTVDGLQSSLM
A5AMT2_VITVI/80-198--D.KTEN-------------------V---LIVEKILRSLT.PN--FNFIVCS---IEEA..NDVGL.LSIDELQIELI
Q2QXM6_ORYSJ/85-203--E.DIND-------------------Q---KVVEKILISLP.EK--YEYIVAA---IEES..KDLST.LTIQQLMSSLE
Q6L3N8_SOLDE/84-202--E.KIDN-------------------Q---IVVSKVLRSLT.TK--FEHVVTA---IEES..KDLST.YSFDELMSSLL
A6YTD9_CUCME/91-209--E.EVGD-------------------Q---RVVEKILRSMP.RK--FEHIVVA---IEES..KDLST.LSINSLMGSLQ
Q9M2D1_ARATH/89-207--E.KLDD-------------------V---RIMEKVLRSLD.LK--FEHIVTV---IEET..KDLEA.MTIEQLLGSLQ
B9IN28_POPTR/105-223--E.DVPE-------------------N---RIVQKLLMSLS.RR--YKSIVSI---IEET..RDLDV.LRAEEVIASVK
A5BLB0_VITVI/283-400--E.EISD-------------------K---RIVEKLLISLP.SK--FDPIVAV---IEET..KDLSL.LSAQELFG.FK
Q9LH44_ARATH/87-205--E.EKSD-------------------Y---QVVQKILISVP.QQ--FDSIVGV---LEQT..KDLST.LSVTELIGTLK
Q9ZQE9_ARATH/91-209--E.KKTN-------------------T---QLIQKILISLP.AK--FDSIVSV---LEQT..RDLDA.LTMSELLGILK
A5B9M8_VITVI/90-208--E.AFTD-------------------Q---KVVEKIMVSVP.QK--FEAKISA---IEES..CDLQT.LTIVELTSKLH
A5BRD1_VITVI/91-209--I.DFSD-------------------S---RIVQKISITIP.EK--FETTISS---LENS..KDVSS.ITLAKLLNALQ
A5B779_VITVI/91-209--K.DFSD-------------------E---RIVQKILITLP.EK--YESKISS---LEES..KDLSS.ISLAELVNALQ
Q9SEL2_VITVI/89-207--K.EFSN-------------------E---KIVQKILVTLP.KK--YEATISS---LENS..KDLST.ISLTELLHSLE
A5BFD6_VITVI/89-207--K.EFSN-------------------E---RVVQKNFVTLP.EK--YEATISS---LENT..KDLSS.ITLAELLNALQ
B9N6H7_POPTR/91-209--I.SFTD-------------------F---RIIEKNLVTVP.EK--YKALITT---LENT..KDLSK.ITLAELLNALQ
B9HFW3_POPTR/91-209--K.SFTD-------------------S---TIVEKIMVTVP.KK--YEASITI---LENT..KDLSK.ITLAERLNALQ
B9P8C1_POPTR/91-209--S.SLPE-------------------S---RIVQKILVTIP.EI--FEATITS---LENT..KDMSK.ITLTEMLNALQ
A5BRW6_VITVI/90-208--E.KFPD-------------------A---RIVEKVLVTLP.ER--FESKISS---LEES..RDLSQ.ISLAEIINALQ
Q6L3X6_SOLDE/202-320--E.EFTD-------------------K---RIVEKVLVTLP.ER--FESKISS---FEKS..KDLGK.LSLGELMGALQ
A5ACV7_VITVI/90-208--E.ELTN-------------------Q---RVVEKVLVSLP.ER--FESKISS---LENS..KDLTK.ISLAELVHAFQ
Q6L3Y5_SOLDE/89-207--E.KVEE-------------------Q---RIVEKVIVTLP.EK--FEAKISS---IEDT..WDMSR.VTLNELSNALL
Q60EG1_ORYSJ/85-201--A.TLND-------------------A---AMVKKLFDTVP.EK--FPSRRD.---.REF..YNVDD.MPFEEAVGRLK
C6JSM1_SORBI/92-210--G.SLED-------------------A---ALVKKLFDTVP.GR--YIHVIAG---IEQF..YDLQT.MKFEDAVGRLK
B6TPM7_MAIZE/94-212--A.TLDD-------------------A---AMVKKLLDTVP.DR--LFPVVAG---IEQF..CDVET.MPFEEALGRLK
Q9SHT5_ARATH/47-166--E.EIEE-------------------S---KIVKKFLKSLPRKK--YIHIIAA---LEQI..LDLNT.TGFEDIVGRMK
Q9ZUF2_ARATH/41-160--E.DIEE-------------------T---KVVKKFLKSLPTKK--YIHIVAA---LEQV..LDLKN.TTFKDIVGRIK
Q4ABY7_BRACM/83-202--E.IIEE-------------------P---KLVKKFLKSLPRKK--YIHMVAS---LEQV..LDLNS.TSFEDIVGRLK
Q9LQK3_ARATH/80-199--V.NIEV-------------------P---KLVKKFLNSLPRKK--YIHIIAS---LEQV..LDLNN.TSFEDIIGRMK
Q9SKV6_ARATH/80-199--S.NIET-------------------S---KLVKKFLNALPLRK--YIHIIAS---LEQV..LDLNN.TSFEDIVGRIK
Q9LE43_ARATH/83-202--E.NIET-------------------E---KLVKKFLKSLPRKK--YIQIVAS---LEQV..LDLKN.TSFEDIVGRIK
B6REL9_9BRAS/81-200--E.VIEE-------------------P---KLVKKFLNSLPRKK--YIHIIAS---LEQV..LNLNE.TGFEDIVGRLK
B6REL1_9BRAS/60-179--E.VIEE-------------------S---KLVKKFLKSLPRYK--FIHIIAS---FEQV..LDLNT.TGNEDIVGRLK
B9PCS7_POPTR/86-204--A.KLEE-------------------S---EVVEKLFSSVP.DR--FLQIIGT---IEQF..GDVDT.MSVSEAIGRLR
Q7F814_ORYSJ/95-213--T.KVEE-------------------T---TVVEKLLHSVP.DK--FQPLIST---IEQW..GDVSE.MTVTETIGRLR
B8BA29_ORYSI/100-218--E.AMDE-------------------K---YVVKKKLRAVS.TK--FISVASS---LMLF..SNINK.MAMEEAIVSLK
D3IVE4_9POAL/219-337--D.KIEE-------------------S---VAVKKYLRVLL.EN--FVPVVTT---LIYS..PDLEE.KKIEEITGSLK
Q7X7K3_ORYSJ/176-294--D.NITD-------------------A---EVVQKLLQVVP.EH--LQQIAIS---IETL..LDVNE.LSLEEVTGSLR
Q0J5Y3_ORYSJ/115-233--D.NISD-------------------A---DVVRKMLDVVP.EH--LEQIAVA---VETL..LDLNT.VSVEEVTGRLR
Q7XH44_ORYSJ/165-269--G.DLPE-------------------I---DVI...........--....AIS---IETL..LDIRD.LSIKEVTVRLR
Q2QYR6_ORYSJ/52-170--D.PIID-------------------K---DVVKKMLEVVP.KY--LEQVAIS---IETL..LDLAT.VSIEEVIGRLR
Q5TKD7_ORYSJ/109-227--G.TLTD-------------------E---HMLKKLLRVVP.FH--YHQLALS---IEQM..LDLKT.MPLEELVGRLA
Q7XTU6_ORYSJ/114-232--G.VMED-------------------E---HVNKKLLRVVP.KK--YKPVAIS---LEQL..LDVKT.MALEELVGRLS
Q8LMZ0_ORYSJ/135-253--D.PLEE-------------------E---KVVQKFLRVVP.SR--FVQVAIA---IEQL..LDLKT.LSIEEVTGRLR
Q7G5Z8_ORYSJ/110-228--A.MMEE-------------------E---MVVKKFLRVVP.SK--YTQVAIS---IEQL..IDLKT.LSVEELTGRLK
Q53P77_ORYSJ/86-204--D.PEPD-------------------D---KVVEKYLCVAR.PR--FSQLVLS---IETL..LDIST.LTLEEVTGRLK
Q2QZL2_ORYSJ/49-167--D.PEPA-------------------D---KVVEKYLRVAR.PR--FNQLILS---IETL..LDIST.LSMEEVTGRLK
Q7XWP2_ORYSJ/116-231--D.PEPD-------------------D---KVVEKYLHVAR.PR--FSQLAAE---.......DYQTPPSSQNTDGKLY
Q10C26_ORYSJ/22-139--A.PIEE-------------------S---KVVQKFLNAVP.EH--LQQIALS---IETL..LDVEE.LSLEEVTGHW.
Q7XUD9_ORYSJ/115-233--V.HLEE-------------------G---KVVEKFLNSVP.DH--LSQIALS---IETL..LDLDE.LTLEEVTGRLR
Q25AF6_ORYSA/117-235--E.RIEE-------------------Q---NVIEKFLRVVP.ER--FSQIAVS---IETL..LDLST.LTIEDVTRRLK
C1IJC5_HORVU/114-232--D.AISD-------------------K---RAIQKWLRIVP.KR--YSQLVLS---IDNL..VDLDT.TSIEEVIGRFK
C5Y7F6_SORBI/35-153--E.TSVD-------------------D---TRVVKFLRVVP.SR--YNQVAVA---IEMS..SDLKT.LSIDEFVGCLR
Q94I41_ORYSJ/94-212--E.EMED-------------------S---RVVKKVLRVVP.KR--LKQVAVA---IEML..ADIDT.MEIEELVGRLQ
C5XUK3_SORBI/218-337--DKDITE-------------------E---RVVEKFLRTVP.AK--YAQIVVA---IEQF..LDFEA.LTLEEVTGRLK
C5XQM0_SORBI/100-219--ERNLDE-------------------E---RAVEKLLRATP.KK--YAQLKIA---IETL..LDFQD.LTIEDVIGRLK
Q9AUM6_ORYSJ/569-688--DTTIDE-------------------E---RAVEKLLRVVP.EK--YTQLALS---IETL..LDFTE.LTIEEVMGRLK
Q2QWI2_ORYSJ/47-166--DDTYDE-------------------E---RAVEKLFRCVP.EK--YRQIARS---IESL..LDLST.MTIEEALGRLK
C5Z583_SORBI/100-218--K.KVDD-------------------E---DLVTKLLCTVP.AR--YSQLAMS---IETM..LDIST.LSLEDVAGRLR
C5WNA6_SORBI/224-342--V.TINE-------------------E---EAVFKYLHSVP.PK--YIQIALS---IETM..LDLST.LIIEDVTGRLR
D3IVP8_9POAL/630-749--V.IYSD-------------------S---DNARQILNALDMSV--WEVLVTT---INHS..VNMET.LTLNDLYSKIK
D3IVT7_9POAL/58-177--L.VFTK-------------------S---ENAHQLLGALDVKV--WGIKITS---INDN..TVMSE.LTMDKLYSRLK
D3IVI1_9POAL/86-205--L.TYPD-------------------S---DNARQMLTALDLRV--WEMKVTT---IKDT..TDLST.LTLDALYSRLK
Q10PG0_ORYSJ/85-204--K.EFSD-------------------N---DNARHLLNCLDYGV--WEMKVTS---ITES..APLSD.LTMDKLYSKLK
D3IVI3_9POAL/99-218--I.EYSQ-------------------S---ENATHLLATINTKE--WEMKATT---IEEN..INLSD.LILELLYSKLK
Q5H9X1_ORYSJ/112-231--SKDMTD-------------------E---VVVKKMVRAIT.PR--NSTLVTI---IRER..PDYKT.LTPYDLLGRIL
Q10NE5_ORYSJ/129-248--SEDMTN-------------------H---FVVKRLLRAFG.PR--YPTLVSM---IRER..KDFKR.LTPSDILGRIV
C5WYF6_SORBI/63-181--G.DLDD-------------------H---RVVKVMLEAYS.PR--NETVVTL---IRDK..KNFEH.FTPSDVLGRLL
Q8S467_MAIZE/138-257--SKKWDD-------------------H---EVVKVILRSLI.FL--NPTQVQL---IRGN..PRYTL.MTPEEVIGNFV
Q8H6I4_MAIZE/204-323--SEDWSD-------------------S---KVTRLFMRAYK.EK--DKSLARM---IRDR..DDYED.MTPHQLFAKIQ
Q33BC8_ORYSJ/86-203--A.TYTD-------------------L---EVAQKMLRALP.KK--YETLVTM---LINS...DMSR.MTPASLLGKIN
A2Q5V3_MEDTR/101-218--E.KLSD-------------------E---KLVRKILRS.P.KR--FYMKVTA---IEEA..QEVSN.MQVEELIGSLQ
O65147_SOYBN/76-194--E.RMTD-------------------E---KLVRKILRSLP.KR--FDMKVTA---IEEA..QDICN.MRVDELIGSLQ
A5BZ48_VITVI/103-221--E.PIPN-------------------S---KVVRKILRSLS.ER--FRAKVTA---IEES..KDVDS.LKVDELVGSLQ
Q9XEB1_ARATH/433-551--K.TYKD-------------------K---KMVKKFLRSLP.DK--FQSHKSA---IDVS..LNSDQ.LKFDQVVGMMQ
Q9FG84_ARATH/101-219--K.KYKD-------------------K---KLVKKLLRCLP.SR--FESKRTA---MGTS..LDTDT.IDFEEVVGMLQ
Q9ZV83_ARATH/82-200--K.TYKD-------------------Q---KLVKKLLRCLP.PK--FAAHKAV---MRVA..GNTDK.ISFVDLVGMLK
A2I5F8_BETVU/104-223--K.FISS-------------------E---EQVRKVLRSLPKDR--WMTKVTA---LQET..KDFTK.FNLEQLAGSLM
A5BW11_VITVI/73-191--K.TYKE-------------------S---EKVMKILRFLP.SK--WHTKLTA---IQEA..KDLTK.LPMEELVGSLM
Q1S5J6_MEDTR/118-236--K.SYVA-------------------S---DHVSKILRSLP.SR--WRPKVTA---IEEA..KDLNT.LSVEDLVSSLK
Q9FJT0_ARATH/33-146--W.KVEE-------------------K---ILVKKILSSLP.PR--FDKVLVE---VAEK........LSVNVIIDCLL
Q9LJD1_ARATH/93-210--L.EKSD-------------------Y---EICKNVFTTLS.GS--FDGLDSM---LEEL..IDVHK.MTSKSLVEYFY
Q9LJD1_ARATH/509-622--I.AKSD-------------------Y---QVIEKVLATLS.GS--YDDVAPV---LGDL..VDLKN.MSLKSFVELFY
Q9LJC8_ARATH/91-202--N.PISD-------------------D---KVITKLLTSLS.WP--YDDSIPV---LKEF..MTLPD.LTLRDLLKAFE
Q9LJC9_ARATH/91-203--N.PISD-------------------E---KVIAKLLTSLP.RP--YDDSITV---LKEF..MTLPD.LTHRDLLKAFE
A9TSN8_PHYPA/23-136--Q.LPSD-------------------I---VAVHKILKILP.AK--FETFVRV---LRSE..KDAP...TLENLASRLY

PF14227

A5BY76_VITVI/104-226--K-TYKE-------------------S...KKVIKILRSLPSM...WHTKVTT...IQEV--KDLTK-LPMEELIGSLM
A5B9Z7_VITVI/12-134--R-VINE-------------------S...EKVMKILXSLXSK...WHTKVTA...IQXA--KDLTK-LPMEELLRSLM
A5BSC1_VITVI/688-789--R-VINE-------------------S...EKVMKILRSLPSK...WHTKVTA...IQEA--KDLTK-LPMEELLGSLM
A5BWL8_VITVI/342-448--K-TYKE-------------------S...EKGMKILRSLPSK...WHTKVTA...IQEA--KDLTK-LPLEKLIGSLM
A5BLR1_VITVI/94-215--K-TYKE-------------------S...EKVMKILRSLPSK...WHTKVTT...IQEA--KDLTK-LPMEELIGSLM
A5BLB0_VITVI/282-404--E-EISD-------------------K...RIVEKLLISLPSK...FDPIVAV...IEET--KDLSL-LSAQELFGFKN
Q9LJC9_ARATH/90-212--N-PISD-------------------E...KVIAKLLTSLPRP...YDDSITV...LKEF--MTLPD-LTHRDLLKAFE
Q5AT23_EMENI/392-511--V-KFDS-------------------M...AILIIFLNGLPSK...YDSMKFS......L--PVHED-LTRGVVLSRLQ
D3IVP8_9POAL/629-752--V-IYSD-------------------S...DNARQILNAL..DMSVWEVLVTT...INHS--VNMET-LTLNDLYSKIK
COPIA_DROME/74-192--A-KIEE-------------------M...DKISHLLITLP.SC..YDGIITA....IET--LSEEN-LTLAFVKNRLL
D2A543_TRICA/76-194--A-KLEE-------------------M...DVVCHLLLTLP.KS..FDPLVTA....LET--MEPSK-LTLDFVKGKLL
O96968_BOMMO/78-193--S-TVNE-------------------Q...DKVCHLLLTMP.DS..YNTTITA...LETT--N..VE-LTTEYVKSKLL
Q6XMP8_AEDAL/81-199--S-KLEE-------------------S...DVCSSLALTLP.ES..YDALVTA....LEN--LPENE-LTYEVMKTRLI
B0X5G3_CULQU/101-222--E-GLKP-------------------R...QFVAVILSSLP.MS..YGTLINV....IEG--YPREQ-ITVDFVKSKLR
Q967L5_AEDAE/76-197--T-TLDA-------------------D...TKICLLLRSLP.PS..FDGLVTA....LDS--RSQDD-ITLEVVKSKLM
Q8WRX6_ANOGA/74-195--Q-ELDS-------------------S...LKVAMVLKSMP.ES..YDHLTTT....LET--RSDDD-LTMELVKSKLL
B2CN78_DAPPU/42-160--A-PVSE-------------------I...QIMTKILCTLP.PS..YRSFTTA....WDS--VPAHE-KTIALLTSRLL
A9RF54_PHYPA/34-146--K-PLLE-------------------E...DVVMTLLSSL...ADFYSSLIVA....LES--ISRKD-LTLDYQGCAKD
Q8H023_ORYSJ/210-330--V-KLDD-------------------E...DKAIILLCSLP.PS..FEHVVTT...LTHG--K..DT-VKTEEIISSLL
Q7XSZ1_ORYSJ/103-219--V-KLDD-------------------E...DKAIILLCSLP.PS..YEHVVTT...LMHG--K..DT-IKTEEIISSLL
Q7XLX2_ORYSJ/160-253--V-EVDD-------------------E...DKAIVLLCSLP.ES..YEHV..........--.....-...........
A5BPQ9_VITVI/512-624--V-KFED-------------------E...DKALMLLNSLL.ASSTYENLVTT...LMWG--K..ET-LDLEDITSILL
A5B864_VITVI/32-156--V-KFED-------------------E...DKALMLLNSLP.ASSTYEIWSVN...YGYV--LMNNN-VSCKVTRIGNI
Q9AU17_SOLCI/79-196--V-KIEE-------------------E...DKRIVLLNSLP.SS..YDTLSTT...ILHG--K..DS-IQLKDVTSALL
B1N668_SOLLC/75-192--V-KIED-------------------E...DAALILLVSLP.MS..FENFVQS...FIVG--K..DT-VSLEEVRSALH
Q2AA06_ASPOF/859-977--E-KISD-------------------E...YKTIILLGSLPDEE..YDTFLLT...LLNG--R..PS-ISYSEITNALT
B9NAJ4_POPTR/37-154--V-EIDD-------------------E...DKALLLLNSLP.DT..YEHLVTT...LLYG--K..EK-IKFIDVSNALV
Q69FA7_PHAVU/58-175--V-KFED-------------------E...DLALMLVSSLP.DE..FEHLETT...LLHG--K..DN-VSLDVVCSALY
Q6BCY1_IPOBA/74-193--C-KIEP-------------------Q...ERAELLLQSLP.DS..YDQLIIN...LTNN--ILTDY-LVFDDVAAAVL
B8YLY5_MEDTR/73-192--F-KIAE-------------------N...ERAELLLQSLP.DS..YDQLIIN...ITNN--NIADT-LHFDDVAGAIL
Q25A78_ORYSA/77-175--V-KYDE-------------------E...DLGLILLCSLP.SS..YANFRDT...ILYS--R..DT-LTLKEVYDALH
Q53QA4_ORYSJ/75-188--V-KYDD-------------------E...DLGLLLLCSLP.NS..YANFRDT...ILLS--R..DE-LTLKEVYDALQ
Q94LG0_ORYSJ/79-192--V-QFDD-------------------E...DLGLLLLCSLP.SS..YANFRDT...ILLS--R..DE-LTLAEVYEALQ
Q01MJ3_ORYSA/27-111--.-....-------------------.................................D--K..DK-RTGKYVPKGKK
A5BQQ6_VITVI/23-136--V-KYDE-------------------E...YLGLILLCLLS.SS..YVTFRDT...ILYS--R..DT-LTLKEVFDALF
A5BPL2_VITVI/25-141--V-KYDE-------------------E...DLGLILLLSK......XAML......MGNN--ASYKI-VGIGTVKIKMF
Q9SJT2_ARATH/93-212--V-LVSD-------------------E...DQAILLLMSLP.KP..FDQLRDT...LKYG--LGRVT-LSLDEVVAAIY
Q9SH77_ARATH/93-212--V-IISD-------------------E...DQAILLLTALP.KA..FDQLKDT...LKYS--SGKSI-LTLDEVAAAIY
Q9FFM0_ARATH/98-215--V-VVPD-------------------E...DQAIVLLMSLP.RQ..FDQLKET...LKY.--.CKTT-LHLEEITSAIR
Q9LS18_ARATH/107-224--V-YVSD-------------------E...DKAFMLLLSLP.RK..LEQLKYS...LDY.--.CEEP-LTLGRVMTAIY
Q9ZQE4_ARATH/102-211--V-DVTE-------------------E...VQAILLLSSL......YDRKENS.......--...QK-VESSQSEGLYV
Q9LJS6_ARATH/105-202--V-NVTK-------------------E.....................RIKES.......--...GK-LSKTQSEGLYV
O81903_ARATH/103-220--I-QVGE-------------------E...VQAILILNSLP.PS..YIQLKHT...LKY.--.GNKT-LSVQDVVSSAK
Q9SHR5_ARATH/101-218--I-QVDE-------------------E...VQAILILNSLP.AS..HIQLKHT...LKY.--.GNKT-LTVQDVTSSAK
Q9LVY5_ARATH/105-222--I-KVAE-------------------E...VQAILILNSLP.VT..YDQLKHT...LKY.--.GNKT-LSVKDVVSSSK
Q02900_ARATH/97-214--I-NVVE-------------------E...VRAILFLNGLS.SR..YSQLKHT...LKY.--.GNKA-LSLQDVISSAR
O82196_ARATH/63-180--I-QVPD-------------------E...VQAILILSALP.DS..YDMLKET...LKY.--.GREG-IKLDDVISAAK
Q9ZPU5_ARATH/68-187--I-DVTD-------------------E...VQAILLLSSLP.AR..YDGLVET...MKYS--NSREK-LRLDDVMVAAR
Q1KUM3_9ROSI/117-234--V-KVEE-------------------E...YQAVYLLNSLP.PA..YEQLREV...LKY.--.SRAT-ISVEEVKAAAR
A5AR03_VITVI/133-256--V-RIXD-------------------E...DQAVILLNSLP.KV..FDQLRDN...LKY.--.SKYM-LSLECVEXHHK
A5ARG5_VITVI/22-139--V-KIED-------------------E...DQAVLLLNSLP.KV..FDQLRDT...LKY.--.SKDS-LSLEGVVSAIH
Q9M3C1_ARATH/26-145--I-NTSD-------------------E...DQALQFMAGLP.PQ..YDSLVDT...LKYG--SGKDT-LTLNAVISSAY
A5AJF1_VITVI/465-574--I-TILD-------------------E...DKAILLLTSLD.AS..YTNMKEA...IMYG--R..DS-LTFD.......
A5BLL6_VITVI/78-195--I-VVLD-------------------E...DKAIMLPTSLD.AS..YTNMKEA...IMYE--R..DN-MTFDEVQSILH
A5BYU4_VITVI/59-176--I-IVSN-------------------E...DKAIVLLTSLD.AS..YTNLKEA...IMYG--I..DS-LTFDDLQSILY
A5BPE6_VITVI/78-195--V-KVEE-------------------E...DQAMILLCSLP.SS..YENFVDT...MMYG--R..BS-ISXNDVKDALQ
Q18L98_CITSI/80-198--V-KICD-------------------E...DKAFFLLSSLP.KS..YEGFVDT...MLYG--R..TT-LTLEDVKASLS
A5B6C0_VITVI/29-150--V-RIDD-------------------E...NQTIILMCSLS.NS..YEHFLNT...MVYG--R..DT-IYIENVRAALN
A5AYK3_VITVI/32-152--V-KVNY-------------------E...DQAIFLMCSLP.NS..YEHFVDI...MMYG--R..GT-LFIKDVRVALN
A5B8Q0_VITVI/529-644--I-RIDD-------------------E...DQAMTLISSLP.NS..YGHFVDT...MMYG--R..DT-LSIEDVREALN
Q2AA73_ASPOF/71-191--V-KIND-------------------E...DQALLLLCSLL.PS..YKHFRDT...MIYG--R..DS-IGIKDAKENLL
A5AM57_VITVI/98-215--F-KVED-------------------E...DKAIILLNSLP.KS..LKHFKET...LKY.--.GRDA-ITFDDVQNALN
A5C6J6_VITVI/77-184--I-KVEK-------------------E...DQAILLLSYLP.KV..YDHFLET...LLHG--K..QT-LTMSKVKEGHY
A5AQ94_VITVI/78-195--I-KVDD-------------------E...DKAVLVLKSLP.GL..YSNFKET...MKYG--R..KT-LTLEEVQSALR
A5AKU3_VITVI/615-723--I-EVDD-------------------E...DKAVLVLNSLP.SS..YSSFKEX...MKYG--R..KT-LTLEEVQNGEG
C6GFP7_FRAAN/52-171--A-KMDD-------------------E...DTAVMLLHSLP.PL..FKHFKTT...MIFK--...EL-ITLSKVCENPK
A5C6L3_VITVI/78-195--I-DFDD-------------------E...IRALIVLASLP.NS..WEAMRMA...VSNS--TGKEK-LKYNDIRDLIL
A5BCL0_VITVI/55-172--I-NFND-------------------E...AHTLILLTSPP.NS..WEPKRAT...VNNS--IDSAK-LKFNDVKDQIL
A5AL15_VITVI/39-145--I-DFDD-------------------E...NYGKVYLVDV....................--KLLDT-VGVGDIHLKML
B9NKT0_POPTR/77-196--L-ELAD-------------------E...MQALILLSSLP.DS..WETLVVS...LSNS--TPNGK-LTLKTVKDCIL
Q6RZV5_MUSAC/23-145--M-NIDD-------------------E...IQGLLLLSSLS.ES..WETFVVT...ICNS--TLEGT-LTIDMVKDSLL
Q9ZRJ0_TOBAC/76-193--I-KFDD-------------------E...VLALMVLATLP.ES..WETLKVS...ITNS--APNGV-VNMETVKSGIL
Q5MG99_IPOBA/76-193--I-KFED-------------------E...VLGLWLLNTLP.DS..WETFRVS...LTNS--APNGV-VTMEYVKSGIL
A5AJF5_VITVI/76-192--I-KFEE-------------------E...MQGLWLLGTLS.DS..WETFRTS...LSNS--APDGT-MNMDLVKSCVL
A5BEP3_VITVI/54-180--I-KFEE-------------------E...VQGLWLLGTLSDSA..YKYCRQLKRDMKQG--KVNDK-KNDNGGEDDRV
B3N452_DROER/17-137--I-DISE-------------------E...LRSIILLSSLP.KD..YENFVVA....IET--R.DTL-PDFEVLRIKVK
B4N7F3_DROWI/52-172--V-QIKE-------------------E...LRTIILFSSLP.PA..YENFVVA....IET--R.DDM-PSFEILRIKLK
B6V6Z8_DROME/78-198--I-TIND-------------------E...LKSIMLLSSLP.NS..WENFVVA....IET--R.DTL-PTFETVKVKLL
B4NQE5_DROWI/78-198--V-TIGD-------------------D...LLAILLLYSLP.DT..YETFRCA....IET--R.DEL-PSPDILRVKIL
Q45W64_PHACH/80-192--G-KITD-------------------E...DFAFNILSALP.PS..WESFVAA.......--.QNNV-EKSSDVIGRVL
Q5JMV2_ORYSJ/12-126--V-KLDD-------------------K...DKVIILLSSLPTP...HEHVVTT...MTYG--KVKHD-NDTGTSKGK..
A5CA63_VITVI/149-269--K-PVLV-------------------K...EKVFCLLTSLG.PQ..YETFTTT..MLKPP--RPSYS-ELVSQLQSLDQ
Q8W5F6_ORYSJ/80-197--C-VLPD-------------------K...FVDGCIIAKLP.PS..WRSFGTA...LKHK--R..QE-YSVEGLIASLD
Q8LN71_ORYSJ/50-167--C-ELPD-------------------K...FVAGGIIAKLP.PS..WSDFATS...LKHN--R..QE-FSVPDLIGSLG
B7ZXP2_MAIZE/242-358--C-PLPD-------------------K...FVVGGIIAKLP.PS..WKDFATS...LKHK--R..QE-FNVEELIGTLD
Q10LP7_ORYSJ/115-232--I-ALPD-------------------K...FQVGMVIAKLP.PS..WRDFATA...LKHR--M..EE-MTMDDLVASLD
A5BQ76_VITVI/63-180--M-ELSE-------------------S...FQVAAIVEKLP.PS..WKDFKNY...LKHK--H..KE-MGLEDLIVRLK
Q0KIN7_SOLDE/84-201--V-KIGD-------------------N...LIVCGIVDKLP.PS..WKEFQKT...MRHK--Q..KE-TSLETLIMKIR
B9GJ95_POPTR/36-153--H-EMTD-------------------E...QQVQVVIHSLP.SN..WEHIRVN...LTHN--D..NI-KIFDDVARHVE
B9GJ02_POPTR/48-165--H-EMTD-------------------E...QQVQPVIRSLP.SN..WEHMCVN...LIHN--D..NI-KTFDDVAHHVE
Q7Y173_ORYSJ/18-135--M-GIND-------------------D...LLVHFILSSLP.SD..FESFI.....INYN--NQRDK-CKKKFYQGESS
A5B4U1_VITVI/192-309--V-EMSE-------------------S...FLVHFILNTLP.PQ..YGPFK.....ISYN--THKDK-WSINELMTMCV
Q2R404_ORYSJ/102-219--M-KISD-------------------G...FLEHIIMRSLG.PN..YDPFK.....IKYN--TQKEE-WTIQELILHSV
A5BQ76_VITVI/411-528--A-EVDK-------------------A...TQIEMVLNTLP.PS..FQQFR.....LNYN--MNKMD-FTLSKLLNELV
Q0KIL6_SOLDE/90-207--A-EIDN-------------------D...SQVEMILQSLP.DS..FQQFC.....LNYN--MNKMS-LSLAQLLNELQ
Q9SZS9_ARATH/2-131--F-GDEE-------------------DGNGDRWLEVISWEP.RAFVYHNFLTN.......--.EECE-HLISLAKPSMM
B9SXB7_RICCO/3-127--S-FDGD-------------------DGKGERWAEVISWEP.RAFVYHNFLTK.......--.EECE-YLINLAKPNMQ

PF03732

Q9XX53_CAEEL/210-308--I-DYIQ...................S---TALHTFLEGLG-D------------------------------------
PEG10_MOUSE/174-267--.-.WTE...................P---ALMDQFQEGLN-P------------------------------------
Q9AUY8_ARATH/31-127--E-LEDE...................A---VQVRRFLRGLR-V------------------------------------
Q9FWC7_ORYSJ/155-249--.-VFDPSV...............GGK---MLVTRFMNGLT-E------------------------------------
Q9FE41_ORYSJ/775-871--.-.MHL...................E---DAIEMCVHGMQ-Q------------------------------------
Q9LP90_ARATH/163-253--.-GLDD...................Q---KLEGIFLNGLT-G------------------------------------
Q9LMV1_ARATH/257-344--.-.VPD...................E---AAIVA....LR-N------------------------------------
Q9ARZ4_ORYSJ/100-192--.-.ITE...................A---SVINAASAGLL-E------------------------------------
Q9FYC9_ARATH/102-194--.-.LDE...................D---FLVSLYLTGLK-T------------------------------------
Q9SK57_ARATH/214-310--E-LEEE...................Q---AQLRRFIRGLR-I------------------------------------
Q9FRJ2_ORYSJ/81-182--M-PVSE...................P---SQVLNLLRGLN-T------------------------------------
Q9AV68_ORYSJ/351-443--.-.ITD...................D---VIIAAFTKGIR-H------------------------------------
Q9AYB5_ORYSJ/567-664--D-LRND...................E---ERQEKFLGGLN-D------------------------------------
O23529_ARATH/90-186--K-PMEH...................E---EQVERILEGLP-E------------------------------------
O82608_ARATH/272-360--G-INDL...................A---ALST.....LK-K------------------------------------
Q9AYC2_ORYSJ/729-826--D-VRTD...................A---EKQEKFMAGLD-D------------------------------------
Q9FGL3_ARATH/131-241--C-VNTCRNCKCCS.....ATASVNEH---SKIVKFLAGLN-D------------------------------------
Q9SQW9_ARATH/264-354--.-.VTS...................D---ILESAFLNGLR-R------------------------------------
Q9LNM2_ARATH/83-178--T-VADK...................P---QGEAARGRG.R-G------------------------------------
Q9AYB6_ORYSJ/694-791--D-VRED...................E---EKQEKFLAGMD-P------------------------------------
Q9XE67_SORBI/155-252--E-SNTE...................K---KKMYFFKKGLS-T------------------------------------
O49369_ARATH/139-231--.-.FAE...................D---YLVSVYLAGLR-T------------------------------------
Q9ZPF9_ARATH/97-196--V-QEEC...................E---ATMSRFMGGLN-R------------------------------------
Q9XII7_ARATH/126-236--.-.STEALDEPCTCGKAMRLQQKAEQ---AKIVKFLAGLN-E------------------------------------
Q9SIM3_ARATH/131-240--.-.STEALDDPCTCGKAVRLYQKAEK---AKIMKFLAGLN-E------------------------------------
Q9MA68_ARATH/89-183--H-GFKK...................A---SLLSTLYRGAL-P------------------------------------
Q9M225_ARATH/186-282--G-MKDG...................Q---AELRRFMRGLR-P------------------------------------
Q96467_HORVU/82-176--N-GLSL...................W---MIIQIFYAGLN-F------------------------------------
Q9AXC5_ANTHI/295-388--Y-LEDE...................G---RKARKFIEGLK-L------------------------------------
Q9M0T9_ARATH/89-183--H-GFTK...................A---SMLSTLYRGVL-P------------------------------------
Q9SY43_ARATH/188-284--G-MEDD...................Q---AQMRRFLRGLR-P------------------------------------
Q9C7H8_ARATH/150-242--.-.LSE...................E---YLVSVYLAGLR-T------------------------------------
Q9ZNW4_SORBI/210-302--.-GVPK...................E---VAIEAAIKGLR-I------------------------------------
Q9SUN0_ARATH/223-313--R-SRGK...................Q---ARNDR.....R-R------------------------------------
Q9M252_ARATH/163-260--A-GRGE...................Q---SMIRRLMRGLR-P------------------------------------
O93283_TAKRU/149-242--.-.WGE...................T---ALRSAYRRGLS-E------------------------------------
Q9ZQQ3_ARATH/198-290--.-.ISQ...................Q---SALSALRKGLW-Y------------------------------------
Q9ATX2_MAIZE/179-271--.-.VPN...................E---IVIEAMIKGLR-P------------------------------------
O81471_ARATH/148-242--H-SFSE...................V---QLLGTFFRGVD-W------------------------------------
Q9FW76_ORYSJ/181-275--G-SNDP...................A---YFVTKFVDGLK-D------------------------------------
Q9SKF2_ARATH/107-197--H-GFSK...................E---SILKN....LA-Q------------------------------------
Q9SYE8_ARATH/131-230--L-QEDG...................E---AVMSRFMGGLN-R------------------------------------
Q98SV9_TAKRU/117-207--.-.WND...................T---ALRGVFTQGLA-E------------------------------------
Q9SJP0_ARATH/291-382--.-.TPD...................D---AAIAALRNALW-H------------------------------------
Q9XE85_SORBI/114-212--D-VRED...................A---DKQRLFMKGLY-Y------------------------------------
Q9ZS84_SOLLC/150-247--.-.MSD...................E---DKLHNFISGMQ-G------------------------------------
O48967_MAIZE/245-337--.-.ISD...................A---SIITAFRQGVR-D------------------------------------
Q9LZG5_ARATH/148-244--.-KRGE...................H---ELIHKFISGLR-V------------------------------------
Q9SX87_ARATH/132-224--.-.LSE...................D---YLVRVYLDGLH-P------------------------------------
Q9LQH2_ARATH/476-575--I-QEDN...................E---AIMSRFMGGLN-R------------------------------------
Q9FZN9_ARATH/121-215--H-GFSK...................A---SLLSTLYRGVL-P------------------------------------
Q9SLQ0_ORYSI/194-290--L-VEND...................D---AGMARFMGGLN-R------------------------------------
Q9UVC2_PASFU/52-153--.-.WDD...................E---ALQVMYRRGLK-E------------------------------------
Q9ZPG6_ARATH/97-191--H-GFKK...................A---SLLRTLYRGAL-P------------------------------------
Q9ZUK1_ARATH/211-302--V-NRPET.................IQ---DALHRATNWIN-A------------------------------------
Q9FWB1_ARATH/104-198--H-GFRY...................A---TLINTFYMGVD-K------------------------------------
Q9HFY8_COLGL/148-252--.-.MTD...................E---SKVFAFYQGLK-D------------------------------------

PF03564

O17518_CAEEL/85-228--.SKNDS-------------------I---QAQKELYENLVIIIDQLRQLGEH---------LE..DRIFKDLLLKKFS
A7SE42_NEMVE/491-638--VTSEKD-------------------A---AGLRRFYDAVETKHRGLQALGVE---------AAQYESILVPALLEKIP
Q17051_9BILA/155-293--....DN-------------------G---SQLVATVQALERILRQLEQAGEN---------LD..SPLLVFIIEQKLS
Q23992_DROME/160-308--.LNLES-------------------N---KQIKTFIDTINESIYIIKLKAQL---------PEDVDAIFAHIILRKFN
O16669_CAEEL/141-284--VPNNHS-------------------L---QQIQQLWTECVSIFKQLCKIQPD---------AD..NTMIANIITSKLP
A7XDH0_DROAN/157-302--.TNNGE-------------------V---SILRSISDGANEVIRALDSIGHM---------DR..DCWVIHLLLNKID
Q4JS97_ANOGA/133-280--.MKTDS-------------------T---EELARIVNEANRLVRGLERLNEP---------VDKWDTPLTSLLFYKLD
Q4EAY5_9RICK/161-306--.TTKID-------------------V---SVLRKVTDGANEIVRALDAIGEN---------TR..DCWIIFLILQKMD

PF14893

MOAP1_HUMAN/1-327..WQ.VPD-------------------V---EKRRRLLESLRGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRE
D3ZGB3_RAT/1-321..WRHISE-------------------R---ERRRRLVESLGGPALDLLCELLEEHPDTPAQDCLAALVQVFGNKDTVMT
PNM6B_HUMAN/1-320..WQGVSE-------------------R---ERRRRLLEGLRGTALQLVHALLAENPARTAQDCLAALAQVFGDNESQAT
PNML1_PONAB/1-365NNWNATED-------------------Q---HDPPKPLVRRAGAKSRSRRKKQKKNPKQEAVPWKKPKGINSSSTANLED
PNML1_MOUSE/1-364NYWKNTED-------------------H---GDPPKPLVRRPGGKIRSRRRKQKKNLKQEPICWRKSQGSNYNSNYNKVN
D2GZV4_AILME/1-326..WQ.VSD-------------------V---EKRRRLMESLRGPAADVIRILKTNNPSITTAECLKALEQVFGSVESSRD
D2I1P4_AILME/1-328..WRHVSE-------------------R---ERRRQLVESLGGPALDLLCGLLAENPDMPAQDCLAALVQAFGDKDTRVT
Q5BJV6_RAT/1-329..WQ.VSD-------------------V---EKRRRLMESLRGPAFEIIRVLKINNPFITVAECLKTLETIFGIIDNPRA
F1PEY7_CANFA/1-297..WRHVPE-------------------R---ERRRWL.................................XFGDKDPCVT
PNMA3_HUMAN/1-328..WQ.VPE-------------------G---EKRRRLMECLRGPALQVVSGLRASNASITVEECLAALQQVFGPVESHKI
PNMA5_MOUSE/1-324..WQ.VSE-------------------R---EKKQCLLESLRGSALSIMQALWTSNDSLTVEQCLKALKHIFGNKEDSKV
PN6BL_HUMAN/1-327..WCHASE-------------------R---EKKRWLLESLGGPALEVVSGLLEEDTNLSALDCLAALGQVFRNQDTRMT
PNMA5_HUMAN/1-323..WQ.VSE-------------------V---EKRRRLLESLRGPALSIMRVLQANNDSITVEQCLDALKQIFGDKEDFRA

PF14244

A5AE14_VITVI/10-125GK.LKS.LW..DELNNYDS..IPVCTCTRCK-------------------------------------------------
A5AFL1_VITVI/24-172NT.LSR.FWQQLDVFETMDWE.....CXXDA-------------------------------------------------
A5AL35_VITVI/26-142GK.LNV.LW..EELFKHEP..LISCTCCSSC-------------------------------------------------
A5APA9_VITVI/42-180TE..LQGLWWEIDFRHP.....NPMERATDI-------------------------------------------------
A5AR29_VITVI/23-171NT.LTR.LWRQLDTFEVHNWN.....CVTDG-------------------------------------------------
A5ARJ9_VITVI/24-165.......LQHSLPILAKTGHP.....SNWKS-------------------------------------------------
A5ATA8_VITVI/24-171ND..LQGLWREIDFRRP.....NPMQCPADI-------------------------------------------------
A5AW26_VITVI/23-156NK......................LKNPRDV-------------------------------------------------
A5AXC5_VITVI/8-148ST.MSDLWDQLELTEXASLQSNVEYLTRRER-------------------------------------------------
A5AZ64_VITVI/47-175TK.LKS.LW..DELASYND..A...SSGAQQ-------------------------------------------------
A5AZK9_VITVI/143-291N..KLKILWEELDVHQHWEIE.....SPRDA-------------------------------------------------
A5B0N9_VITVI/37-186GE.......LIEFFCELDHRDKVVMKDPEDI-------------------------------------------------
A5B3L9_VITVI/16-147.......LKQELDMFYNLEWT.....CVTDS-------------------------------------------------
A5B8L2_VITVI/15-147....VSSHGKSTTAFKS.....QTVPDGMKC-------------------------------------------------
A5BAZ3_VITVI/31-163NT.LTR.YWQQLDLFETHSWK.....CSDDA-------------------------------------------------
A5BCQ9_VITVI/83-209TK.LKA.FW..DELSSYHE..VLSCSCGGLE-------------------------------------------------
A5BG06_VITVI/43-189SQ..LSLIPTTI.VDLD.....TGMSFLGTN-------------------------------------------------
A5BJC0_VITVI/21-165..DFLVGLNPEFDQVRIYILGKQEVPCFNEV-------------------------------------------------
A5BKK0_VITVI/191-331ND........AYAHVRR.....EDTRQVVMI-------------------------------------------------
A5BM32_VITVI/27-149SE.FKA.LW..DEYISYRP..IPSCRCGNLN-------------------------------------------------
A5BN45_VITVI/28-176NI.LSC.HWQHLDMFEVHTWK.....CPEDT-------------------------------------------------
A5BNR5_VITVI/308-456TK.IKA.LW..DELETYRS....PLTCNQRQ-------------------------------------------------
A5BP26_VITVI/33-181TR.LKI.LW..DELKGFQP..LPECACGTMK-------------------------------------------------
A5BQW4_VITVI/215-363FL.....ISLNQNLDEVREWILGRKPLPSIR-------------------------------------------------
A5BSG2_VITVI/5-152NE..LNSIYMELDYQRS.....NDMTCVVDI-------------------------------------------------
A5BT41_VITVI/40-187NN..LQGLWREIDFRRS.....NPMEYDIDI-------------------------------------------------
A5BVQ3_VITVI/17-164ND..LQGLWREIDFRRP.....NPMECAIDI-------------------------------------------------
A5BWZ5_VITVI/42-189KP..FPTVEQAYAFVRR.....EEVSHK.DD-------------------------------------------------
A5BXA9_VITVI/396-529PS.LRE.DFSEVRREESRKKV.....MMGSK-------------------------------------------------
A5C3H8_VITVI/42-155IK..LQGLWREIDLRRP.....NPMECATDI-------------------------------------------------
A5C4L4_VITVI/24-140TK.LKG.LW..DELASYNA..A...AYGAQQ-------------------------------------------------
A5C4S3_VITVI/27-177TR.QKS.LW..DELREFKA..IPVCNCGGMR-------------------------------------------------
A5C9I0_VITVI/13-150NS.ASK.GK..RLVELFNH..FTLENVLYVP-------------------------------------------------
B9SLN1_RICCO/35-176VA...............NE..SV.AAMAVKN-------------------------------------------------
O22175_ARATH/27-174GR.LIK.LW..EELQNYKS..GRECKCEAAS-------------------------------------------------
O23588_ARATH/73-209TK.KKT.LW..EQLANTRVLTVRKCNCEHVK-------------------------------------------------
Q0PY40_SOLLC/17-166SK.LKT.LW..NEYDVIVP..SPCSTCSQSK-------------------------------------------------
Q2HT49_MEDTR/20-168IE.LCT.LW..DELNSHRP..IPNCTCIHPC-------------------------------------------------
Q2HU07_MEDTR/24-172TS.IKS.LW..EELNSHRP..MPMCTCPYPC-------------------------------------------------
Q6L4J8_SOLDE/13-160VH.QFS.MG..LDDKVFGT..TH...SNILS-------------------------------------------------
Q9FIC5_ARATH/29-177GK.LSQ.LW..RSLADYQQ..AKTMEEVRKE-------------------------------------------------
Q9LGZ8_ARATH/19-166GR.LTK.LW..EELQNYKT..SRTCTCEAAP-------------------------------------------------
Q9M0P5_ARATH/20-169TE.LVT.LW..EEYKNYIE..LPLCTCGRCE-------------------------------------------------
Q9XIM3_ARATH/23-161TR.LKT.LW..DQLDSTEELDDPCTRQKRAK-------------------------------------------------
Q9ZPU4_ARATH/37-185GR.LSN.LW..EEYNIYKP..VTVCTCGLCR-------------------------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A0EVF5_MAIZE/104-132--------------------------------------------------------------------------------
A0EVG6_MAIZE/136-164--------------------------------------------------------------------------------
A0MEB8_ARATH/13-39--------------------------------------------------------------------------------
A2I5F8_BETVU/19-47--------------------------------------------------------------------------------
A2Q2M0_MEDTR/28-56--------------------------------------------------------------------------------
A2Q5V3_MEDTR/14-42--------------------------------------------------------------------------------
A2XQ14_ORYSI/37-63--------------------------------------------------------------------------------
A5ACV7_VITVI/14-40--------------------------------------------------------------------------------
A5ACV9_VITVI/13-39--------------------------------------------------------------------------------
A5ADA3_VITVI/15-41--------------------------------------------------------------------------------
A5AE45_VITVI/21-49--------------------------------------------------------------------------------
A5AFP3_VITVI/14-39--------------------------------------------------------------------------------
A5AGS2_VITVI/15-41--------------------------------------------------------------------------------
A5AHH2_VITVI/133-159--------------------------------------------------------------------------------
A5AHJ1_VITVI/21-49--------------------------------------------------------------------------------
A5AKW8_VITVI/13-39--------------------------------------------------------------------------------
A5AMT2_VITVI/33-58--------------------------------------------------------------------------------
A5ANP1_VITVI/21-49--------------------------------------------------------------------------------
A5ANX8_VITVI/14-40--------------------------------------------------------------------------------
A5AVP1_VITVI/15-40--------------------------------------------------------------------------------
A5AWN8_VITVI/13-39--------------------------------------------------------------------------------
A5AX99_VITVI/16-44--------------------------------------------------------------------------------
A5B0F2_VITVI/14-40--------------------------------------------------------------------------------
A5B1X3_VITVI/15-41--------------------------------------------------------------------------------
A5B3E3_VITVI/45-71--------------------------------------------------------------------------------
A5B612_VITVI/21-49--------------------------------------------------------------------------------
A5B8H9_VITVI/78-103--------------------------------------------------------------------------------
A5BB46_VITVI/210-235--------------------------------------------------------------------------------
A5BD08_VITVI/13-39--------------------------------------------------------------------------------
A5BLB0_VITVI/214-240--------------------------------------------------------------------------------
A5BLE1_VITVI/15-41--------------------------------------------------------------------------------
A5BM96_VITVI/21-49--------------------------------------------------------------------------------
A5BNN7_VITVI/10-36--------------------------------------------------------------------------------
A5BP60_VITVI/21-49--------------------------------------------------------------------------------
A5BQA9_VITVI/73-99--------------------------------------------------------------------------------
A5BRW6_VITVI/14-40--------------------------------------------------------------------------------
A5BSL1_VITVI/14-39--------------------------------------------------------------------------------
A5BTH8_VITVI/21-49--------------------------------------------------------------------------------
A5BV67_VITVI/23-49--------------------------------------------------------------------------------
A5BVS1_VITVI/10-36--------------------------------------------------------------------------------
A5BXS1_VITVI/15-41--------------------------------------------------------------------------------
A5C0Q9_VITVI/16-42--------------------------------------------------------------------------------
A5C3F9_VITVI/15-41--------------------------------------------------------------------------------
A5C3G4_VITVI/99-125--------------------------------------------------------------------------------
A5C753_VITVI/21-49--------------------------------------------------------------------------------
A6FWP0_9RHOB/12-38--------------------------------------------------------------------------------
A6YTD9_CUCME/15-41--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B6REL1_9BRAS/2-28--------------------------------------------------------------------------------
B6REL9_9BRAS/23-49--------------------------------------------------------------------------------
B6REM4_9BRAS/12-38--------------------------------------------------------------------------------
B6TPM7_MAIZE/33-59--------------------------------------------------------------------------------
B6V6Z8_DROME/10-36--------------------------------------------------------------------------------
B8BDZ6_ORYSI/26-52--------------------------------------------------------------------------------
B9FWJ4_ORYSJ/161-187--------------------------------------------------------------------------------
B9GKP2_POPTR/14-40--------------------------------------------------------------------------------
B9GSJ3_POPTR/134-160--------------------------------------------------------------------------------
B9HE40_POPTR/16-42--------------------------------------------------------------------------------
B9HFW3_POPTR/15-41--------------------------------------------------------------------------------
B9HGE2_POPTR/14-40--------------------------------------------------------------------------------
B9HKW4_POPTR/29-55--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
B9HPY3_POPTR/20-46--------------------------------------------------------------------------------
B9I2Y2_POPTR/15-41--------------------------------------------------------------------------------
B9I573_POPTR/13-39--------------------------------------------------------------------------------
B9IBK8_POPTR/14-40--------------------------------------------------------------------------------
B9IK76_POPTR/27-53--------------------------------------------------------------------------------
B9MXT9_POPTR/15-41--------------------------------------------------------------------------------
B9NB79_POPTR/15-41--------------------------------------------------------------------------------
B9NCJ4_POPTR/14-40--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9NL03_POPTR/15-41--------------------------------------------------------------------------------
B9P6D1_POPTR/13-39--------------------------------------------------------------------------------
B9P7V6_POPTR/11-37--------------------------------------------------------------------------------
B9PAL4_POPTR/13-39--------------------------------------------------------------------------------
B9PCS7_POPTR/28-54--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C0JJI1_SOYBN/14-40--------------------------------------------------------------------------------
C1IJC5_HORVU/51-77--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
D3IVE4_9POAL/157-183--------------------------------------------------------------------------------
D3IVI1_9POAL/13-41--------------------------------------------------------------------------------
Q01L11_ORYSA/14-42--------------------------------------------------------------------------------
Q01L55_ORYSA/55-83--------------------------------------------------------------------------------
Q01LI0_ORYSA/9-35--------------------------------------------------------------------------------
Q01MW9_ORYSA/19-45--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q0WNA8_ARATH/12-38--------------------------------------------------------------------------------
Q10B81_ORYSJ/39-67--------------------------------------------------------------------------------
Q10F54_ORYSJ/861-887--------------------------------------------------------------------------------
Q10PG0_ORYSJ/12-40--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q25AF6_ORYSA/59-85--------------------------------------------------------------------------------
Q2QS45_ORYSJ/14-42--------------------------------------------------------------------------------
Q2R0F7_ORYSJ/478-504--------------------------------------------------------------------------------
Q4ABY7_BRACM/25-51--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q6L3N8_SOLDE/17-43--------------------------------------------------------------------------------
Q6XMP8_AEDAL/16-42--------------------------------------------------------------------------------
Q710T7_POPDE/16-42--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XH44_ORYSJ/104-130--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q84VH6_SOYBN/16-44--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
Q8H6I0_MAIZE/134-162--------------------------------------------------------------------------------
Q8H6I4_MAIZE/130-158--------------------------------------------------------------------------------
Q8H6W2_CICAR/19-47--------------------------------------------------------------------------------
Q967L5_AEDAE/11-37--------------------------------------------------------------------------------
Q9C7Y1_ARATH/12-37--------------------------------------------------------------------------------
Q9LE43_ARATH/25-51--------------------------------------------------------------------------------
Q9LH44_ARATH/12-38--------------------------------------------------------------------------------
Q9LIG4_ARATH/14-40--------------------------------------------------------------------------------
Q9LJ55_ARATH/26-52--------------------------------------------------------------------------------
Q9LJD1_ARATH/12-38--------------------------------------------------------------------------------
Q9LJD2_ARATH/12-38--------------------------------------------------------------------------------
Q9LNQ5_ARATH/22-48--------------------------------------------------------------------------------
Q9M1C6_ARATH/15-40--------------------------------------------------------------------------------
Q9MAR7_ARATH/25-51--------------------------------------------------------------------------------
Q9SKV6_ARATH/22-48--------------------------------------------------------------------------------
Q9XEB1_ARATH/10-36--------------------------------------------------------------------------------
Q9XEB1_ARATH/348-376--------------------------------------------------------------------------------
Q9ZQE9_ARATH/12-38--------------------------------------------------------------------------------
Q9ZTG6_TOBAC/19-47--------------------------------------------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204A---AETLV.KKASSM----------------------------------------------------------------
A5BQ76_VITVI/412-525A---AQTII.KQGAAP----------------------------------------------------------------
A5AHT8_VITVI/92-205Q---EEERL.KEEKIE----------------------------------------------------------------
B8BH64_ORYSI/219-332Q---EEERL.KQDRIE----------------------------------------------------------------
A5BI38_VITVI/288-401Q---EEGRL.KMELDE----------------------------------------------------------------
B9GJ95_POPTR/37-150L---EEDRL.LAEKPI----------------------------------------------------------------
A5ANU6_VITVI/96-209I---EEESR.SRDKMV----------------------------------------------------------------
A5B8Q0_VITVI/530-643L---RELKK.RVSESR----------------------------------------------------------------
A5AQ94_VITVI/79-192S---KELEL.KKKGSN----------------------------------------------------------------
Q18L98_CITSI/81-195S---KEIQK.NCELET----------------------------------------------------------------
Q1KUM3_9ROSI/118-231M---KELEL.LAQGTL----------------------------------------------------------------
Q7XTM9_ORYSJ/78-191A---KEKMK.KMVPSE----------------------------------------------------------------
Q01M93_ORYSA/78-191N---KEKMK.IMVQND----------------------------------------------------------------
A5AS33_VITVI/79-194A---EEIHQ.RDAGKT----------------------------------------------------------------
Q2AA06_ASPOF/860-974N---YDLRR.KDKETS----------------------------------------------------------------
Q6XMP8_AEDAL/82-196D---EESKR.NERSYT----------------------------------------------------------------
D2A543_TRICA/77-191D---CELKR.KNQCSE----------------------------------------------------------------
Q9U6V8_DROWI/75-189D---QEIKI.KNDHND----------------------------------------------------------------
A5BIJ4_VITVI/84-197E---HEIYL.KRDMEM----------------------------------------------------------------
Q0ZCD8_POPTR/118-230S---HEAYL.RRLETA----------------------------------------------------------------
A5B6L3_VITVI/126-238A---HEGRI.AHKISS----------------------------------------------------------------
A5BYA6_VITVI/62-174A---HESRV.EKNNSS----------------------------------------------------------------
A5BK17_VITVI/103-215A---QESRI.EKNIKI----------------------------------------------------------------
A5CAE5_VITVI/64-176T---HEQRL.HLQTTA----------------------------------------------------------------
A5BJ70_VITVI/81-193T---HEQRL.HLQHSS----------------------------------------------------------------
A5BFR8_VITVI/115-227A---FEHRL.EQQSSI----------------------------------------------------------------
Q9SV56_ARATH/103-217N---FDDKL.QNGQSG----------------------------------------------------------------
Q9SSB1_ARATH/101-216G---YDDRL.QSYVTE----------------------------------------------------------------
D1GEF6_BRARP/107-222A---FEDRL.KSYTTD----------------------------------------------------------------
C0SQ79_PORYE/115-228E---TELRA.ESDDDV----------------------------------------------------------------
A5B3I2_VITVI/89-207V---HEQRM.SSHVEE----------------------------------------------------------------
A5B8H9_VITVI/153-271V---HEQRM.NDHLVE----------------------------------------------------------------
A5BGM4_VITVI/89-207V---HEQKI.IQEDKE----------------------------------------------------------------
Q9M1C6_ARATH/91-209V---HEQRL.NGHVQE----------------------------------------------------------------
A5BYF7_VITVI/162-280V---HEQRM.NCHSGN----------------------------------------------------------------
A5BY31_VITVI/28-146V---HEQKF.HKKPVE----------------------------------------------------------------
A5BFQ9_VITVI/28-146V---HEQKF.QRRNGE----------------------------------------------------------------
Q9C7Y1_ARATH/87-205V---HEQNL.SRHDVE----------------------------------------------------------------
A5AMT2_VITVI/80-198E---EEEEA.EVGVEE----------------------------------------------------------------
Q2QXM6_ORYSJ/85-203S---HEERK.LQREGS----------------------------------------------------------------
Q6L3N8_SOLDE/84-202A---HEDRL.NRSREK----------------------------------------------------------------
A6YTD9_CUCME/91-209S---HELRL.KQFDVN----------------------------------------------------------------
Q9M2D1_ARATH/89-207A---YEEKK.KKKEDI----------------------------------------------------------------
B9IN28_POPTR/105-223V---YDKRE.DLHDDR----------------------------------------------------------------
A5BLB0_VITVI/283-400N---NQQAS.CAEEKE----------------------------------------------------------------
Q9LH44_ARATH/87-205A---HERRL.NLREDR----------------------------------------------------------------
Q9ZQE9_ARATH/91-209A---QEARV.TAREES----------------------------------------------------------------
A5B9M8_VITVI/90-208A---QEQRV.LMRGDE----------------------------------------------------------------
A5BRD1_VITVI/91-209T---QEQRR.LMRQEG----------------------------------------------------------------
A5B779_VITVI/91-209A---QEQRR.MIRKEE----------------------------------------------------------------
Q9SEL2_VITVI/89-207A---VEQRR.LMRQGD----------------------------------------------------------------
A5BFD6_VITVI/89-207A---LEQRR.LMRQGS----------------------------------------------------------------
B9N6H7_POPTR/91-209A---QEKRR.LMRQDH----------------------------------------------------------------
B9HFW3_POPTR/91-209V---QEQRR.LMRQNR----------------------------------------------------------------
B9P8C1_POPTR/91-209A---QEQRR.IMRQED----------------------------------------------------------------
A5BRW6_VITVI/90-208A---QEQRR.ALKQEN----------------------------------------------------------------
Q6L3X6_SOLDE/202-320A---QEQRR.NMRRDK----------------------------------------------------------------
A5ACV7_VITVI/90-208A---QEQRR.SMRQEE----------------------------------------------------------------
Q6L3Y5_SOLDE/89-207A---VEKRK.AFRKEE----------------------------------------------------------------
Q60EG1_ORYSJ/85-201A---YDERV.RKKKAA----------------------------------------------------------------
C6JSM1_SORBI/92-210A---YEERT.RRGVGE----------------------------------------------------------------
B6TPM7_MAIZE/94-212A---FDERS.RRRTHA----------------------------------------------------------------
Q9SHT5_ARATH/47-166T---YEDRV.CDEDDS----------------------------------------------------------------
Q9ZUF2_ARATH/41-160T---YEDKI.WVLITC----------------------------------------------------------------
Q4ABY7_BRACM/83-202A---YEERI.CEDEEE----------------------------------------------------------------
Q9LQK3_ARATH/80-199V---YEDRV.CDDDEP----------------------------------------------------------------
Q9SKV6_ARATH/80-199V---YEERV.WDGEEQ----------------------------------------------------------------
Q9LE43_ARATH/83-202V---YEERV.WDEEDE----------------------------------------------------------------
B6REL9_9BRAS/81-200A---YEERV.LDDEKQ----------------------------------------------------------------
B6REL1_9BRAS/60-179A---YEERN.GEETQR----------------------------------------------------------------
B9PCS7_POPTR/86-204T---FEEGL.KGRSHT----------------------------------------------------------------
Q7F814_ORYSJ/95-213A---FEESS.KGQRRD----------------------------------------------------------------
B8BA29_ORYSI/100-218A---HEELV.KGREIQ----------------------------------------------------------------
D3IVE4_9POAL/219-337A---HEELL.KGYQSR----------------------------------------------------------------
Q7X7K3_ORYSJ/176-294S---VEQRK.QRKAVA----------------------------------------------------------------
Q0J5Y3_ORYSJ/115-233A---VEQRR.HRSAPV----------------------------------------------------------------
Q7XH44_ORYSJ/165-269S---VEKCK.AKPKEV----------------------------------------------------------------
Q2QYR6_ORYSJ/52-170A---VEQRK.KPASSE----------------------------------------------------------------
Q5TKD7_ORYSJ/109-227A---IESYK.PEWTAR----------------------------------------------------------------
Q7XTU6_ORYSJ/114-232T---VDSYS.DDEEGS----------------------------------------------------------------
Q8LMZ0_ORYSJ/135-253T---VEERY.RPGDND----------------------------------------------------------------
Q7G5Z8_ORYSJ/110-228S---VEERY.EIDGNG----------------------------------------------------------------
Q53P77_ORYSJ/86-204A---VEDSG.QSSSSS----------------------------------------------------------------
Q2QZL2_ORYSJ/49-167A---AEDSG.QSSSHT----------------------------------------------------------------
Q7XWP2_ORYSJ/116-231L---TEEEWLEHHKKE----------------------------------------------------------------
Q10C26_ORYSJ/22-139A---KDCRQ.PRKNTE----------------------------------------------------------------
Q7XUD9_ORYSJ/115-233N---AEEKL.PAKSSA----------------------------------------------------------------
Q25AF6_ORYSA/117-235V---AEERQ.PAPTST----------------------------------------------------------------
C1IJC5_HORVU/114-232A---AEERY.ELDVEE----------------------------------------------------------------
C5Y7F6_SORBI/35-153A---AEDRF.EPFVEQ----------------------------------------------------------------
Q94I41_ORYSJ/94-212V---AEDAD.AEDQAA----------------------------------------------------------------
C5XUK3_SORBI/218-337A---VDNRE.EQALTE----------------------------------------------------------------
C5XQM0_SORBI/100-219T---VDDLD.DEPTHE----------------------------------------------------------------
Q9AUM6_ORYSJ/569-688A---VDNRK.QLPPSE----------------------------------------------------------------
Q2QWI2_ORYSJ/47-166V---VDSDE.PQPLSG----------------------------------------------------------------
C5Z583_SORBI/100-218V---AESRT.TPAPEK----------------------------------------------------------------
C5WNA6_SORBI/224-342A---VDERM.EQATTT----------------------------------------------------------------
D3IVP8_9POAL/630-749T---HDIDI.LARINK----------------------------------------------------------------
D3IVT7_9POAL/58-177T---HEIDF.TLRLPK----------------------------------------------------------------
D3IVI1_9POAL/86-205T---HEIDI.VSRKSK----------------------------------------------------------------
Q10PG0_ORYSJ/85-204T---HEMDV.FHRKGL----------------------------------------------------------------
D3IVI3_9POAL/99-218T---HEIKR.VDYPKK----------------------------------------------------------------
Q5H9X1_ORYSJ/112-231A---HDMLV.QDSKDV----------------------------------------------------------------
Q10NE5_ORYSJ/129-248S---HEMQE.EEAREV----------------------------------------------------------------
C5WYF6_SORBI/63-181T---FDMQR.LKKFDM----------------------------------------------------------------
Q8S467_MAIZE/138-257S---FECMI.KGSKKI----------------------------------------------------------------
Q8H6I4_MAIZE/204-323Q---HESEE.APIKTR----------------------------------------------------------------
Q33BC8_ORYSJ/86-203T---NDMYK.LKKKEM----------------------------------------------------------------
A2Q5V3_MEDTR/101-218N---YELVV.DNRTEK----------------------------------------------------------------
O65147_SOYBN/76-194T---FELGL.SDRTEK----------------------------------------------------------------
A5BZ48_VITVI/103-221T---FEMTL.GSPRKS----------------------------------------------------------------
Q9XEB1_ARATH/433-551A---YDTDK.EEILNS----------------------------------------------------------------
Q9FG84_ARATH/101-219A---YELEI.TSGKGG----------------------------------------------------------------
Q9ZV83_ARATH/82-200L---EEMKA.DQDKVK----------------------------------------------------------------
A2I5F8_BETVU/104-223T---HELHL.DTEYGE----------------------------------------------------------------
A5BW11_VITVI/73-191T---YEINL.TKKLQE----------------------------------------------------------------
Q1S5J6_MEDTR/118-236V---HEMSL.NEHEIS----------------------------------------------------------------
Q9FJT0_ARATH/33-146V---HEYNM.RPDQES----------------------------------------------------------------
Q9LJD1_ARATH/93-210.---..YRV.HESSTE----------------------------------------------------------------
Q9LJD1_ARATH/509-622V---YDSIT.EESIHL----------------------------------------------------------------
Q9LJC8_ARATH/91-202L---FGSHP....ETM----------------------------------------------------------------
Q9LJC9_ARATH/91-203M---FGSNP....KTM----------------------------------------------------------------
A9TSN8_PHYPA/23-136I---EEMAF.KQRKEQ----------------------------------------------------------------

PF14227

A5BY76_VITVI/104-226T...YEINL-AKKLQEGED-------------------------------------------------------------
A5B9Z7_VITVI/12-134T...YEISL-TKQLQKSED-------------------------------------------------------------
A5BSC1_VITVI/688-789T...YEISL-TKQLQESED-------------------------------------------------------------
A5BWL8_VITVI/342-448T...YEINL-AKKQQESED-------------------------------------------------------------
A5BLR1_VITVI/94-215T...YEINL-AKKLQEGED-------------------------------------------------------------
A5BLB0_VITVI/282-404N...QQASC-AEEKEADEN-------------------------------------------------------------
Q9LJC9_ARATH/90-212MFGSNPKTM-PQELMKFIN-------------------------------------------------------------
Q5AT23_EMENI/392-511Q...QDSMM-STAKENWIV-------------------------------------------------------------
D3IVP8_9POAL/629-752T...HDIDI-LARINKPNS-------------------------------------------------------------
COPIA_DROME/74-192D...QEIKI-KNDHNDTSK-------------------------------------------------------------
D2A543_TRICA/76-194D...CELKR-KNQCSEIEV-------------------------------------------------------------
O96968_BOMMO/78-193D...AE..L-KNQNNSMES-------------------------------------------------------------
Q6XMP8_AEDAL/81-199D...EESKR-NERSYTVGD-------------------------------------------------------------
B0X5G3_CULQU/101-222DEWRRRQEC-QEFQSGPSD-------------------------------------------------------------
Q967L5_AEDAE/76-197DEFLRRLER-DGHPVKKEK-------------------------------------------------------------
Q8WRX6_ANOGA/74-195DEAQKRMEK-SHQSESILR-------------------------------------------------------------
B2CN78_DAPPU/42-160K...EETMA-KRWTRGQKD-------------------------------------------------------------
A9RF54_PHYPA/34-146E...EEPPF-EDEEVHYQS-------------------------------------------------------------
Q8H023_ORYSJ/210-330ARDLRRSKK-NEAMEASQA-------------------------------------------------------------
Q7XSZ1_ORYSJ/103-219ARDLRRSKK-NEAMEASQA-------------------------------------------------------------
Q7XLX2_ORYSJ/160-253......MRK-NKEGETSQA-------------------------------------------------------------
A5BPQ9_VITVI/512-624G...FNKKK-KANNESSRG-------------------------------------------------------------
A5B864_VITVI/32-156KIKMFDGVV-RTLCDVRHV-------------------------------------------------------------
Q9AU17_SOLCI/79-196L...NEKMR-KKPENHGQV-------------------------------------------------------------
B1N668_SOLLC/75-192S...RELRH-KANGTSTDI-------------------------------------------------------------
Q2AA06_ASPOF/859-977N...YDLRR-KDKETSHAS-------------------------------------------------------------
B9NAJ4_POPTR/37-154N...NEYRK-KDQIVHKES-------------------------------------------------------------
Q69FA7_PHAVU/58-175S...HELRK-QDKMKTKST-------------------------------------------------------------
Q6BCY1_IPOBA/74-193E...EESRR-KNKEDRQVN-------------------------------------------------------------
B8YLY5_MEDTR/73-192E...EESRR-KNKEERSES-------------------------------------------------------------
Q25A78_ORYSA/77-175A...K....-EKMKKMVPS-------------------------------------------------------------
Q53QA4_ORYSJ/75-188N...K....-EKMKIMVQN-------------------------------------------------------------
Q94LG0_ORYSJ/79-192N...R....-EKMKGMVQS-------------------------------------------------------------
Q01MJ3_ORYSA/27-111E...E....-EGKAAVVTD-------------------------------------------------------------
A5BQQ6_VITVI/23-136S...K....-EKMKQLVVR-------------------------------------------------------------
A5BPL2_VITVI/25-141DGIVTTLSD-VRRILDLKR-------------------------------------------------------------
Q9SJT2_ARATH/93-212S...KELEL-GSNKKSIKG-------------------------------------------------------------
Q9SH77_ARATH/93-212S...KELEL-GSVKKSIKV-------------------------------------------------------------
Q9FFM0_ARATH/98-215S...KILEL-GASGKLLKN-------------------------------------------------------------
Q9LS18_ARATH/107-224K...KELEV-AQIERQTEE-------------------------------------------------------------
Q9ZQE4_ARATH/102-211E...QEADQ-RRGLKKEKA-------------------------------------------------------------
Q9LJS6_ARATH/105-202E...TRGRL-EKRFDKGKG-------------------------------------------------------------
O81903_ARATH/103-220S...LEREL-SEQKETIRA-------------------------------------------------------------
Q9SHR5_ARATH/101-218S...LEREL-AEAVDLDKG-------------------------------------------------------------
Q9LVY5_ARATH/105-222S...LEREM-AELKENTKV-------------------------------------------------------------
Q02900_ARATH/97-214S...LEREL-DEQKETDKN-------------------------------------------------------------
O82196_ARATH/63-180S...KELEL-RDSSGGSRP-------------------------------------------------------------
Q9ZPU5_ARATH/68-187D...KEREL-SQNNRPVVE-------------------------------------------------------------
Q1KUM3_9ROSI/117-234M...KELEL-LAQGTLTRG-------------------------------------------------------------
A5AR03_VITVI/133-256RECPKRKPK-KNDQBSESX-------------------------------------------------------------
A5ARG5_VITVI/22-139A...KKMDI-RVERIGTTS-------------------------------------------------------------
Q9M3C1_ARATH/26-145S...KEIEL-KEKGLLNVS-------------------------------------------------------------
A5AJF1_VITVI/465-574....EETKH-SQENREWGD-------------------------------------------------------------
A5BLL6_VITVI/78-195A...RELQK-QEESKEKSG-------------------------------------------------------------
A5BYU4_VITVI/59-176A...RELQK-QEESKDESD-------------------------------------------------------------
A5BPE6_VITVI/78-195S...KELQK-LVSGSEEGS-------------------------------------------------------------
Q18L98_CITSI/80-198S...KEIQK-NCELETSNG-------------------------------------------------------------
A5B6C0_VITVI/29-150SRELKNKVF-KSREDDSSE-------------------------------------------------------------
A5AYK3_VITVI/32-152SRELKKMVF-KSRKYDSGE-------------------------------------------------------------
A5B8Q0_VITVI/529-644L...RE..L-KKRVSESRK-------------------------------------------------------------
Q2AA73_ASPOF/71-191NTEKINKEL-TTSESGDKA-------------------------------------------------------------
A5AM57_VITVI/98-215A...KVAPI-ICVQEINGG-------------------------------------------------------------
A5C6J6_VITVI/77-184K...KECPE-RKKKAEKLN-------------------------------------------------------------
A5AQ94_VITVI/78-195S...KELEL-KKKGSNGEG-------------------------------------------------------------
A5AKU3_VITVI/615-723LFIKGRXDK-RNNKGKASS-------------------------------------------------------------
C6GFP7_FRAAN/52-171SYIRLEREE-DSSQARGLY-------------------------------------------------------------
A5C6L3_VITVI/78-195A...EE..I-RRRDAGETS-------------------------------------------------------------
A5BCL0_VITVI/55-172I...DK..V-RRIDLGKAS-------------------------------------------------------------
A5AL15_VITVI/39-145NGFIWKIHK-VRHVPKLMH-------------------------------------------------------------
B9NKT0_POPTR/77-196N...EEKRR-KGTSTSESH-------------------------------------------------------------
Q6RZV5_MUSAC/23-145N...EDARR-KEQGESSFG-------------------------------------------------------------
Q9ZRJ0_TOBAC/76-193N...EE..M-RRRSQGTSS-------------------------------------------------------------
Q5MG99_IPOBA/76-193N...EE..A-RRRSQDTST-------------------------------------------------------------
A5AJF5_VITVI/76-192N...EE..M-GRKSQG.SS-------------------------------------------------------------
A5BEP3_VITVI/54-180ATTTSNFLI-VYENFFTSY-------------------------------------------------------------
B3N452_DROER/17-137EKGERRCQF-GPSDMQAQA-------------------------------------------------------------
B4N7F3_DROWI/52-172EEAERKRLT-VTKENGQEA-------------------------------------------------------------
B6V6Z8_DROME/78-198EEGARKQER-DDREGSVQA-------------------------------------------------------------
B4NQE5_DROWI/78-198EESEARQAK-KAREEQSAV-------------------------------------------------------------
Q45W64_PHACH/80-192S...EN..L-RRQSKGDTT-------------------------------------------------------------
Q5JMV2_ORYSJ/12-126....EKRVM-RPRLKTTGA-------------------------------------------------------------
A5CA63_VITVI/149-269R...RNWFS-NHANATHAT-------------------------------------------------------------
Q8W5F6_ORYSJ/80-197V...EEKTR-EKYAASKGD-------------------------------------------------------------
Q8LN71_ORYSJ/50-167V...EEKAR-AKDVQGKKV-------------------------------------------------------------
B7ZXP2_MAIZE/242-358V...EERAR-TKDN.GKGV-------------------------------------------------------------
Q10LP7_ORYSJ/115-232V...EEKAR-AKDAPLVNE-------------------------------------------------------------
A5BQ76_VITVI/63-180I...EEDNH-VFEKKVGKH-------------------------------------------------------------
Q0KIN7_SOLDE/84-201M...EEEAR-GQDALLQTE-------------------------------------------------------------
B9GJ95_POPTR/36-153L...EEDRL-LAEKPINKA-------------------------------------------------------------
B9GJ02_POPTR/48-165L...EEDRF-HSEKPINEA-------------------------------------------------------------
Q7Y173_ORYSJ/18-135N...SQNKK-KKPNTPSTQ-------------------------------------------------------------
A5B4U1_VITVI/192-309Q...EEGSL-IYKSECVGN-------------------------------------------------------------
Q2R404_ORYSJ/102-219E...EEERQ-KAGKQKVKD-------------------------------------------------------------
A5BQ76_VITVI/411-528A...AQTII-KQGAAPVVL-------------------------------------------------------------
Q0KIL6_SOLDE/90-207A...AETLV-KKASSMALN-------------------------------------------------------------
Q9SZS9_ARATH/2-131KSKVVDVKT-GKSIDSRFC-------------------------------------------------------------
B9SXB7_RICCO/3-127KSTVVDSET-GRSKDSRVR-------------------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308--------------------------------------------------------------------------------
PEG10_MOUSE/174-267--------------------------------------------------------------------------------
Q9AUY8_ARATH/31-127--------------------------------------------------------------------------------
Q9FWC7_ORYSJ/155-249--------------------------------------------------------------------------------
Q9FE41_ORYSJ/775-871--------------------------------------------------------------------------------
Q9LP90_ARATH/163-253--------------------------------------------------------------------------------
Q9LMV1_ARATH/257-344--------------------------------------------------------------------------------
Q9ARZ4_ORYSJ/100-192--------------------------------------------------------------------------------
Q9FYC9_ARATH/102-194--------------------------------------------------------------------------------
Q9SK57_ARATH/214-310--------------------------------------------------------------------------------
Q9FRJ2_ORYSJ/81-182--------------------------------------------------------------------------------
Q9AV68_ORYSJ/351-443--------------------------------------------------------------------------------
Q9AYB5_ORYSJ/567-664--------------------------------------------------------------------------------
O23529_ARATH/90-186--------------------------------------------------------------------------------
O82608_ARATH/272-360--------------------------------------------------------------------------------
Q9AYC2_ORYSJ/729-826--------------------------------------------------------------------------------
Q9FGL3_ARATH/131-241--------------------------------------------------------------------------------
Q9SQW9_ARATH/264-354--------------------------------------------------------------------------------
Q9LNM2_ARATH/83-178--------------------------------------------------------------------------------
Q9AYB6_ORYSJ/694-791--------------------------------------------------------------------------------
Q9XE67_SORBI/155-252--------------------------------------------------------------------------------
O49369_ARATH/139-231--------------------------------------------------------------------------------
Q9ZPF9_ARATH/97-196--------------------------------------------------------------------------------
Q9XII7_ARATH/126-236--------------------------------------------------------------------------------
Q9SIM3_ARATH/131-240--------------------------------------------------------------------------------
Q9MA68_ARATH/89-183--------------------------------------------------------------------------------
Q9M225_ARATH/186-282--------------------------------------------------------------------------------
Q96467_HORVU/82-176--------------------------------------------------------------------------------
Q9AXC5_ANTHI/295-388--------------------------------------------------------------------------------
Q9M0T9_ARATH/89-183--------------------------------------------------------------------------------
Q9SY43_ARATH/188-284--------------------------------------------------------------------------------
Q9C7H8_ARATH/150-242--------------------------------------------------------------------------------
Q9ZNW4_SORBI/210-302--------------------------------------------------------------------------------
Q9SUN0_ARATH/223-313--------------------------------------------------------------------------------
Q9M252_ARATH/163-260--------------------------------------------------------------------------------
O93283_TAKRU/149-242--------------------------------------------------------------------------------
Q9ZQQ3_ARATH/198-290--------------------------------------------------------------------------------
Q9ATX2_MAIZE/179-271--------------------------------------------------------------------------------
O81471_ARATH/148-242--------------------------------------------------------------------------------
Q9FW76_ORYSJ/181-275--------------------------------------------------------------------------------
Q9SKF2_ARATH/107-197--------------------------------------------------------------------------------
Q9SYE8_ARATH/131-230--------------------------------------------------------------------------------
Q98SV9_TAKRU/117-207--------------------------------------------------------------------------------
Q9SJP0_ARATH/291-382--------------------------------------------------------------------------------
Q9XE85_SORBI/114-212--------------------------------------------------------------------------------
Q9ZS84_SOLLC/150-247--------------------------------------------------------------------------------
O48967_MAIZE/245-337--------------------------------------------------------------------------------
Q9LZG5_ARATH/148-244--------------------------------------------------------------------------------
Q9SX87_ARATH/132-224--------------------------------------------------------------------------------
Q9LQH2_ARATH/476-575--------------------------------------------------------------------------------
Q9FZN9_ARATH/121-215--------------------------------------------------------------------------------
Q9SLQ0_ORYSI/194-290--------------------------------------------------------------------------------
Q9UVC2_PASFU/52-153--------------------------------------------------------------------------------
Q9ZPG6_ARATH/97-191--------------------------------------------------------------------------------
Q9ZUK1_ARATH/211-302--------------------------------------------------------------------------------
Q9FWB1_ARATH/104-198--------------------------------------------------------------------------------
Q9HFY8_COLGL/148-252--------------------------------------------------------------------------------

PF03564

O17518_CAEEL/85-228E---KIRRKVYEQKLKDQG-------------------------------------------------------------
A7SE42_NEMVE/491-638E---AVRLS.ITRGKSHEN-------------------------------------------------------------
Q17051_9BILA/155-293Q---RIKRR.ISEYKALDP-------------------------------------------------------------
Q23992_DROME/160-308K---ESLNLYESHVKKTKE-------------------------------------------------------------
O16669_CAEEL/141-284R---RYIKR.IYFG.HRDC-------------------------------------------------------------
A7XDH0_DROAN/157-302P---ESRRKWVDASRASNS-------------------------------------------------------------
Q4JS97_ANOGA/133-280S---KTLVAWEQYSVDFKT-------------------------------------------------------------
Q4EAY5_9RICK/161-306A---ETRRKWIEDSRDLNS-------------------------------------------------------------

PF14893

MOAP1_HUMAN/1-327LQVKYLTTY-QKDEEKLSA....YVLRLEPLLQKLVQRGAIE.RDAVNQARLDQVIAGAVHKTI..........RRELNL
D3ZGB3_RAT/1-321ARLKFLTCS-QRPQETLFA....YVMRLEGLLQMAMEKGAIQ.PAMVDQARARQVLMRARPNQMLQN.......NLRRMR
PNM6B_HUMAN/1-320IRVKCLTAQ-QQSGERLSA....FVLRLEVLLQKAMEKEALA.RASADRVRLRQMLTRAHLTEPLDE.......ALRKLR
PNML1_PONAB/1-365PEVGD.AES-MAISEPIKGSRKPCVKQEELALKKPMAKCAWKGPREPPQDAQAEAESPGGASESDQDGGHESPPKKKAMA
PNML1_MOUSE/1-364LEAGEAAQS-SEIPESVKSNKKPFVKQEETVWKK...KRVWRDPSDLPRSALPAADSPGNLEDSDQDGGPENPAKKKAMT
D2GZV4_AILME/1-326AQVRFLNTY-QNPGEKLSA....YVIRLEPLLQKVVEKGAID.KDNVNQARLEQVIAGANHSGAIRR.......QLWLTG
D2I1P4_AILME/1-328ARLKFLTCA-QRPRETLFA....YVMRLEGLLQSAVEKGAFH.PVIADQVRARQVLMRARPNEMLQN.......KLRRMR
Q5BJV6_RAT/1-329LQVRYLTTY-QKSGEKLSA....YVLRLEPLLQKLVQKGAIE.KEVVNQARLDQVIAGAIHKSV..........RRELGL
F1PEY7_CANFA/1-297ARLKFLTCA-QRPQETLFA....YVMRLEGLLQSAVEKGAIH.PTIADQVRARQVLMRARSNEMLQS.......KLKRMR
PNMA3_HUMAN/1-328AQVKLCKAY-QEAGEKVSS....FVLRLEPLLQRAVENNVVS.RRNVNQTRLKRVLSGATLPDKLRD.......KLKLMK
PNMA5_MOUSE/1-324LQFRFLQSS-QKPAEKVSD....YLLRLEPLLQKAVQQSPLS.AHSADSIRLKHVLSQVSMTTGLRG.......KLSLLD
PN6BL_HUMAN/1-327SRLKFLTCT-QGPQEGLFA....FVVRLEGLLQRAVEKGAVC.PALANYLRLQQVLSWARPSEALQD.......TLRGMQ
PNMA5_HUMAN/1-323SQFRFLQTS-PKIGEKVST....FLLRLEPLLQKAVHKSPLS.VRSTDMIRLKHLLARVAMTPALRG.......KLELLD

PF14244

A5AE14_VITVI/10-125--------------
A5AFL1_VITVI/24-172--------------
A5AL35_VITVI/26-142--------------
A5APA9_VITVI/42-180--------------
A5AR29_VITVI/23-171--------------
A5ARJ9_VITVI/24-165--------------
A5ATA8_VITVI/24-171--------------
A5AW26_VITVI/23-156--------------
A5AXC5_VITVI/8-148--------------
A5AZ64_VITVI/47-175--------------
A5AZK9_VITVI/143-291--------------
A5B0N9_VITVI/37-186--------------
A5B3L9_VITVI/16-147--------------
A5B8L2_VITVI/15-147--------------
A5BAZ3_VITVI/31-163--------------
A5BCQ9_VITVI/83-209--------------
A5BG06_VITVI/43-189--------------
A5BJC0_VITVI/21-165--------------
A5BKK0_VITVI/191-331--------------
A5BM32_VITVI/27-149--------------
A5BN45_VITVI/28-176--------------
A5BNR5_VITVI/308-456--------------
A5BP26_VITVI/33-181--------------
A5BQW4_VITVI/215-363--------------
A5BSG2_VITVI/5-152--------------
A5BT41_VITVI/40-187--------------
A5BVQ3_VITVI/17-164--------------
A5BWZ5_VITVI/42-189--------------
A5BXA9_VITVI/396-529--------------
A5C3H8_VITVI/42-155--------------
A5C4L4_VITVI/24-140--------------
A5C4S3_VITVI/27-177--------------
A5C9I0_VITVI/13-150--------------
B9SLN1_RICCO/35-176--------------
O22175_ARATH/27-174--------------
O23588_ARATH/73-209--------------
Q0PY40_SOLLC/17-166--------------
Q2HT49_MEDTR/20-168--------------
Q2HU07_MEDTR/24-172--------------
Q6L4J8_SOLDE/13-160--------------
Q9FIC5_ARATH/29-177--------------
Q9LGZ8_ARATH/19-166--------------
Q9M0P5_ARATH/20-169--------------
Q9XIM3_ARATH/23-161--------------
Q9ZPU4_ARATH/37-185--------------

PF13961

Q5AT23_EMENI/319-345--------------
Q5AT23_EMENI/515-541--------------
A0EVF5_MAIZE/104-132--------------
A0EVG6_MAIZE/136-164--------------
A0MEB8_ARATH/13-39--------------
A2I5F8_BETVU/19-47--------------
A2Q2M0_MEDTR/28-56--------------
A2Q5V3_MEDTR/14-42--------------
A2XQ14_ORYSI/37-63--------------
A5ACV7_VITVI/14-40--------------
A5ACV9_VITVI/13-39--------------
A5ADA3_VITVI/15-41--------------
A5AE45_VITVI/21-49--------------
A5AFP3_VITVI/14-39--------------
A5AGS2_VITVI/15-41--------------
A5AHH2_VITVI/133-159--------------
A5AHJ1_VITVI/21-49--------------
A5AKW8_VITVI/13-39--------------
A5AMT2_VITVI/33-58--------------
A5ANP1_VITVI/21-49--------------
A5ANX8_VITVI/14-40--------------
A5AVP1_VITVI/15-40--------------
A5AWN8_VITVI/13-39--------------
A5AX99_VITVI/16-44--------------
A5B0F2_VITVI/14-40--------------
A5B1X3_VITVI/15-41--------------
A5B3E3_VITVI/45-71--------------
A5B612_VITVI/21-49--------------
A5B8H9_VITVI/78-103--------------
A5BB46_VITVI/210-235--------------
A5BD08_VITVI/13-39--------------
A5BLB0_VITVI/214-240--------------
A5BLE1_VITVI/15-41--------------
A5BM96_VITVI/21-49--------------
A5BNN7_VITVI/10-36--------------
A5BP60_VITVI/21-49--------------
A5BQA9_VITVI/73-99--------------
A5BRW6_VITVI/14-40--------------
A5BSL1_VITVI/14-39--------------
A5BTH8_VITVI/21-49--------------
A5BV67_VITVI/23-49--------------
A5BVS1_VITVI/10-36--------------
A5BXS1_VITVI/15-41--------------
A5C0Q9_VITVI/16-42--------------
A5C3F9_VITVI/15-41--------------
A5C3G4_VITVI/99-125--------------
A5C753_VITVI/21-49--------------
A6FWP0_9RHOB/12-38--------------
A6YTD9_CUCME/15-41--------------
A9RSN5_PHYPA/14-40--------------
B0D6P6_LACBS/11-37--------------
B0WQU4_CULQU/10-36--------------
B0WWB7_CULQU/11-37--------------
B4K1A4_DROGR/12-38--------------
B4LA17_DROMO/10-36--------------
B4LAF9_DROMO/10-36--------------
B4LE08_DROVI/13-41--------------
B4MX54_DROWI/10-37--------------
B4NQE5_DROWI/11-37--------------
B4NQR9_DROWI/10-36--------------
B6HA76_PENCW/19-46--------------
B6QCF0_PENMQ/36-62--------------
B6REL1_9BRAS/2-28--------------
B6REL9_9BRAS/23-49--------------
B6REM4_9BRAS/12-38--------------
B6TPM7_MAIZE/33-59--------------
B6V6Z8_DROME/10-36--------------
B8BDZ6_ORYSI/26-52--------------
B9FWJ4_ORYSJ/161-187--------------
B9GKP2_POPTR/14-40--------------
B9GSJ3_POPTR/134-160--------------
B9HE40_POPTR/16-42--------------
B9HFW3_POPTR/15-41--------------
B9HGE2_POPTR/14-40--------------
B9HKW4_POPTR/29-55--------------
B9HL08_POPTR/16-42--------------
B9HPY3_POPTR/20-46--------------
B9I2Y2_POPTR/15-41--------------
B9I573_POPTR/13-39--------------
B9IBK8_POPTR/14-40--------------
B9IK76_POPTR/27-53--------------
B9MXT9_POPTR/15-41--------------
B9NB79_POPTR/15-41--------------
B9NCJ4_POPTR/14-40--------------
B9NDW0_POPTR/15-41--------------
B9NL03_POPTR/15-41--------------
B9P6D1_POPTR/13-39--------------
B9P7V6_POPTR/11-37--------------
B9PAL4_POPTR/13-39--------------
B9PCS7_POPTR/28-54--------------
B9RBX9_RICCO/17-43--------------
B9RC68_RICCO/10-37--------------
B9S5P6_RICCO/16-42--------------
C0JJI1_SOYBN/14-40--------------
C1IJC5_HORVU/51-77--------------
C5GBD9_AJEDR/188-215--------------
C5WNA6_SORBI/166-192--------------
C5XQM0_SORBI/42-68--------------
C5XUK3_SORBI/137-163--------------
C5Z583_SORBI/42-68--------------
C6JSM1_SORBI/23-49--------------
C7J1L6_ORYSJ/181-207--------------
C7J1U3_ORYSJ/16-44--------------
C7J5A1_ORYSJ/49-75--------------
C7J6P4_ORYSJ/14-42--------------
C7J7K5_ORYSJ/83-109--------------
D0NBZ2_PHYIT/18-44--------------
D0P386_PHYIT/3-29--------------
D0P4P1_PHYIT/16-42--------------
D0RLQ9_PHYIT/21-47--------------
D2A4C7_TRICA/13-39--------------
D2A543_TRICA/14-40--------------
D3IVE4_9POAL/157-183--------------
D3IVI1_9POAL/13-41--------------
Q01L11_ORYSA/14-42--------------
Q01L55_ORYSA/55-83--------------
Q01LI0_ORYSA/9-35--------------
Q01MW9_ORYSA/19-45--------------
Q0DA14_ORYSJ/28-54--------------
Q0IZT5_ORYSJ/33-59--------------
Q0J5Y3_ORYSJ/54-80--------------
Q0WNA8_ARATH/12-38--------------
Q10B81_ORYSJ/39-67--------------
Q10F54_ORYSJ/861-887--------------
Q10PG0_ORYSJ/12-40--------------
Q16S15_AEDAE/12-38--------------
Q25AF6_ORYSA/59-85--------------
Q2QS45_ORYSJ/14-42--------------
Q2R0F7_ORYSJ/478-504--------------
Q4ABY7_BRACM/25-51--------------
Q6K285_ORYSJ/82-108--------------
Q6L3N8_SOLDE/17-43--------------
Q6XMP8_AEDAL/16-42--------------
Q710T7_POPDE/16-42--------------
Q75M81_ORYSJ/48-74--------------
Q7G5Z8_ORYSJ/52-78--------------
Q7G756_ORYSJ/12-40--------------
Q7XH44_ORYSJ/104-130--------------
Q7XKY1_ORYSJ/53-79--------------
Q7XMT1_ORYSJ/56-82--------------
Q84Q85_ORYSJ/36-62--------------
Q84VH6_SOYBN/16-44--------------
Q850T3_ORYSJ/12-40--------------
Q8H6I0_MAIZE/134-162--------------
Q8H6I4_MAIZE/130-158--------------
Q8H6W2_CICAR/19-47--------------
Q967L5_AEDAE/11-37--------------
Q9C7Y1_ARATH/12-37--------------
Q9LE43_ARATH/25-51--------------
Q9LH44_ARATH/12-38--------------
Q9LIG4_ARATH/14-40--------------
Q9LJ55_ARATH/26-52--------------
Q9LJD1_ARATH/12-38--------------
Q9LJD2_ARATH/12-38--------------
Q9LNQ5_ARATH/22-48--------------
Q9M1C6_ARATH/15-40--------------
Q9MAR7_ARATH/25-51--------------
Q9SKV6_ARATH/22-48--------------
Q9XEB1_ARATH/10-36--------------
Q9XEB1_ARATH/348-376--------------
Q9ZQE9_ARATH/12-38--------------
Q9ZTG6_TOBAC/19-47--------------

PF14223

Q0KIL6_SOLDE/91-204--------------
A5BQ76_VITVI/412-525--------------
A5AHT8_VITVI/92-205--------------
B8BH64_ORYSI/219-332--------------
A5BI38_VITVI/288-401--------------
B9GJ95_POPTR/37-150--------------
A5ANU6_VITVI/96-209--------------
A5B8Q0_VITVI/530-643--------------
A5AQ94_VITVI/79-192--------------
Q18L98_CITSI/81-195--------------
Q1KUM3_9ROSI/118-231--------------
Q7XTM9_ORYSJ/78-191--------------
Q01M93_ORYSA/78-191--------------
A5AS33_VITVI/79-194--------------
Q2AA06_ASPOF/860-974--------------
Q6XMP8_AEDAL/82-196--------------
D2A543_TRICA/77-191--------------
Q9U6V8_DROWI/75-189--------------
A5BIJ4_VITVI/84-197--------------
Q0ZCD8_POPTR/118-230--------------
A5B6L3_VITVI/126-238--------------
A5BYA6_VITVI/62-174--------------
A5BK17_VITVI/103-215--------------
A5CAE5_VITVI/64-176--------------
A5BJ70_VITVI/81-193--------------
A5BFR8_VITVI/115-227--------------
Q9SV56_ARATH/103-217--------------
Q9SSB1_ARATH/101-216--------------
D1GEF6_BRARP/107-222--------------
C0SQ79_PORYE/115-228--------------
A5B3I2_VITVI/89-207--------------
A5B8H9_VITVI/153-271--------------
A5BGM4_VITVI/89-207--------------
Q9M1C6_ARATH/91-209--------------
A5BYF7_VITVI/162-280--------------
A5BY31_VITVI/28-146--------------
A5BFQ9_VITVI/28-146--------------
Q9C7Y1_ARATH/87-205--------------
A5AMT2_VITVI/80-198--------------
Q2QXM6_ORYSJ/85-203--------------
Q6L3N8_SOLDE/84-202--------------
A6YTD9_CUCME/91-209--------------
Q9M2D1_ARATH/89-207--------------
B9IN28_POPTR/105-223--------------
A5BLB0_VITVI/283-400--------------
Q9LH44_ARATH/87-205--------------
Q9ZQE9_ARATH/91-209--------------
A5B9M8_VITVI/90-208--------------
A5BRD1_VITVI/91-209--------------
A5B779_VITVI/91-209--------------
Q9SEL2_VITVI/89-207--------------
A5BFD6_VITVI/89-207--------------
B9N6H7_POPTR/91-209--------------
B9HFW3_POPTR/91-209--------------
B9P8C1_POPTR/91-209--------------
A5BRW6_VITVI/90-208--------------
Q6L3X6_SOLDE/202-320--------------
A5ACV7_VITVI/90-208--------------
Q6L3Y5_SOLDE/89-207--------------
Q60EG1_ORYSJ/85-201--------------
C6JSM1_SORBI/92-210--------------
B6TPM7_MAIZE/94-212--------------
Q9SHT5_ARATH/47-166--------------
Q9ZUF2_ARATH/41-160--------------
Q4ABY7_BRACM/83-202--------------
Q9LQK3_ARATH/80-199--------------
Q9SKV6_ARATH/80-199--------------
Q9LE43_ARATH/83-202--------------
B6REL9_9BRAS/81-200--------------
B6REL1_9BRAS/60-179--------------
B9PCS7_POPTR/86-204--------------
Q7F814_ORYSJ/95-213--------------
B8BA29_ORYSI/100-218--------------
D3IVE4_9POAL/219-337--------------
Q7X7K3_ORYSJ/176-294--------------
Q0J5Y3_ORYSJ/115-233--------------
Q7XH44_ORYSJ/165-269--------------
Q2QYR6_ORYSJ/52-170--------------
Q5TKD7_ORYSJ/109-227--------------
Q7XTU6_ORYSJ/114-232--------------
Q8LMZ0_ORYSJ/135-253--------------
Q7G5Z8_ORYSJ/110-228--------------
Q53P77_ORYSJ/86-204--------------
Q2QZL2_ORYSJ/49-167--------------
Q7XWP2_ORYSJ/116-231--------------
Q10C26_ORYSJ/22-139--------------
Q7XUD9_ORYSJ/115-233--------------
Q25AF6_ORYSA/117-235--------------
C1IJC5_HORVU/114-232--------------
C5Y7F6_SORBI/35-153--------------
Q94I41_ORYSJ/94-212--------------
C5XUK3_SORBI/218-337--------------
C5XQM0_SORBI/100-219--------------
Q9AUM6_ORYSJ/569-688--------------
Q2QWI2_ORYSJ/47-166--------------
C5Z583_SORBI/100-218--------------
C5WNA6_SORBI/224-342--------------
D3IVP8_9POAL/630-749--------------
D3IVT7_9POAL/58-177--------------
D3IVI1_9POAL/86-205--------------
Q10PG0_ORYSJ/85-204--------------
D3IVI3_9POAL/99-218--------------
Q5H9X1_ORYSJ/112-231--------------
Q10NE5_ORYSJ/129-248--------------
C5WYF6_SORBI/63-181--------------
Q8S467_MAIZE/138-257--------------
Q8H6I4_MAIZE/204-323--------------
Q33BC8_ORYSJ/86-203--------------
A2Q5V3_MEDTR/101-218--------------
O65147_SOYBN/76-194--------------
A5BZ48_VITVI/103-221--------------
Q9XEB1_ARATH/433-551--------------
Q9FG84_ARATH/101-219--------------
Q9ZV83_ARATH/82-200--------------
A2I5F8_BETVU/104-223--------------
A5BW11_VITVI/73-191--------------
Q1S5J6_MEDTR/118-236--------------
Q9FJT0_ARATH/33-146--------------
Q9LJD1_ARATH/93-210--------------
Q9LJD1_ARATH/509-622--------------
Q9LJC8_ARATH/91-202--------------
Q9LJC9_ARATH/91-203--------------
A9TSN8_PHYPA/23-136--------------

PF14227

A5BY76_VITVI/104-226--------------
A5B9Z7_VITVI/12-134--------------
A5BSC1_VITVI/688-789--------------
A5BWL8_VITVI/342-448--------------
A5BLR1_VITVI/94-215--------------
A5BLB0_VITVI/282-404--------------
Q9LJC9_ARATH/90-212--------------
Q5AT23_EMENI/392-511--------------
D3IVP8_9POAL/629-752--------------
COPIA_DROME/74-192--------------
D2A543_TRICA/76-194--------------
O96968_BOMMO/78-193--------------
Q6XMP8_AEDAL/81-199--------------
B0X5G3_CULQU/101-222--------------
Q967L5_AEDAE/76-197--------------
Q8WRX6_ANOGA/74-195--------------
B2CN78_DAPPU/42-160--------------
A9RF54_PHYPA/34-146--------------
Q8H023_ORYSJ/210-330--------------
Q7XSZ1_ORYSJ/103-219--------------
Q7XLX2_ORYSJ/160-253--------------
A5BPQ9_VITVI/512-624--------------
A5B864_VITVI/32-156--------------
Q9AU17_SOLCI/79-196--------------
B1N668_SOLLC/75-192--------------
Q2AA06_ASPOF/859-977--------------
B9NAJ4_POPTR/37-154--------------
Q69FA7_PHAVU/58-175--------------
Q6BCY1_IPOBA/74-193--------------
B8YLY5_MEDTR/73-192--------------
Q25A78_ORYSA/77-175--------------
Q53QA4_ORYSJ/75-188--------------
Q94LG0_ORYSJ/79-192--------------
Q01MJ3_ORYSA/27-111--------------
A5BQQ6_VITVI/23-136--------------
A5BPL2_VITVI/25-141--------------
Q9SJT2_ARATH/93-212--------------
Q9SH77_ARATH/93-212--------------
Q9FFM0_ARATH/98-215--------------
Q9LS18_ARATH/107-224--------------
Q9ZQE4_ARATH/102-211--------------
Q9LJS6_ARATH/105-202--------------
O81903_ARATH/103-220--------------
Q9SHR5_ARATH/101-218--------------
Q9LVY5_ARATH/105-222--------------
Q02900_ARATH/97-214--------------
O82196_ARATH/63-180--------------
Q9ZPU5_ARATH/68-187--------------
Q1KUM3_9ROSI/117-234--------------
A5AR03_VITVI/133-256--------------
A5ARG5_VITVI/22-139--------------
Q9M3C1_ARATH/26-145--------------
A5AJF1_VITVI/465-574--------------
A5BLL6_VITVI/78-195--------------
A5BYU4_VITVI/59-176--------------
A5BPE6_VITVI/78-195--------------
Q18L98_CITSI/80-198--------------
A5B6C0_VITVI/29-150--------------
A5AYK3_VITVI/32-152--------------
A5B8Q0_VITVI/529-644--------------
Q2AA73_ASPOF/71-191--------------
A5AM57_VITVI/98-215--------------
A5C6J6_VITVI/77-184--------------
A5AQ94_VITVI/78-195--------------
A5AKU3_VITVI/615-723--------------
C6GFP7_FRAAN/52-171--------------
A5C6L3_VITVI/78-195--------------
A5BCL0_VITVI/55-172--------------
A5AL15_VITVI/39-145--------------
B9NKT0_POPTR/77-196--------------
Q6RZV5_MUSAC/23-145--------------
Q9ZRJ0_TOBAC/76-193--------------
Q5MG99_IPOBA/76-193--------------
A5AJF5_VITVI/76-192--------------
A5BEP3_VITVI/54-180--------------
B3N452_DROER/17-137--------------
B4N7F3_DROWI/52-172--------------
B6V6Z8_DROME/78-198--------------
B4NQE5_DROWI/78-198--------------
Q45W64_PHACH/80-192--------------
Q5JMV2_ORYSJ/12-126--------------
A5CA63_VITVI/149-269--------------
Q8W5F6_ORYSJ/80-197--------------
Q8LN71_ORYSJ/50-167--------------
B7ZXP2_MAIZE/242-358--------------
Q10LP7_ORYSJ/115-232--------------
A5BQ76_VITVI/63-180--------------
Q0KIN7_SOLDE/84-201--------------
B9GJ95_POPTR/36-153--------------
B9GJ02_POPTR/48-165--------------
Q7Y173_ORYSJ/18-135--------------
A5B4U1_VITVI/192-309--------------
Q2R404_ORYSJ/102-219--------------
A5BQ76_VITVI/411-528--------------
Q0KIL6_SOLDE/90-207--------------
Q9SZS9_ARATH/2-131--------------
B9SXB7_RICCO/3-127--------------

PF03732

Q9XX53_CAEEL/210-308--------------
PEG10_MOUSE/174-267--------------
Q9AUY8_ARATH/31-127--------------
Q9FWC7_ORYSJ/155-249--------------
Q9FE41_ORYSJ/775-871--------------
Q9LP90_ARATH/163-253--------------
Q9LMV1_ARATH/257-344--------------
Q9ARZ4_ORYSJ/100-192--------------
Q9FYC9_ARATH/102-194--------------
Q9SK57_ARATH/214-310--------------
Q9FRJ2_ORYSJ/81-182--------------
Q9AV68_ORYSJ/351-443--------------
Q9AYB5_ORYSJ/567-664--------------
O23529_ARATH/90-186--------------
O82608_ARATH/272-360--------------
Q9AYC2_ORYSJ/729-826--------------
Q9FGL3_ARATH/131-241--------------
Q9SQW9_ARATH/264-354--------------
Q9LNM2_ARATH/83-178--------------
Q9AYB6_ORYSJ/694-791--------------
Q9XE67_SORBI/155-252--------------
O49369_ARATH/139-231--------------
Q9ZPF9_ARATH/97-196--------------
Q9XII7_ARATH/126-236--------------
Q9SIM3_ARATH/131-240--------------
Q9MA68_ARATH/89-183--------------
Q9M225_ARATH/186-282--------------
Q96467_HORVU/82-176--------------
Q9AXC5_ANTHI/295-388--------------
Q9M0T9_ARATH/89-183--------------
Q9SY43_ARATH/188-284--------------
Q9C7H8_ARATH/150-242--------------
Q9ZNW4_SORBI/210-302--------------
Q9SUN0_ARATH/223-313--------------
Q9M252_ARATH/163-260--------------
O93283_TAKRU/149-242--------------
Q9ZQQ3_ARATH/198-290--------------
Q9ATX2_MAIZE/179-271--------------
O81471_ARATH/148-242--------------
Q9FW76_ORYSJ/181-275--------------
Q9SKF2_ARATH/107-197--------------
Q9SYE8_ARATH/131-230--------------
Q98SV9_TAKRU/117-207--------------
Q9SJP0_ARATH/291-382--------------
Q9XE85_SORBI/114-212--------------
Q9ZS84_SOLLC/150-247--------------
O48967_MAIZE/245-337--------------
Q9LZG5_ARATH/148-244--------------
Q9SX87_ARATH/132-224--------------
Q9LQH2_ARATH/476-575--------------
Q9FZN9_ARATH/121-215--------------
Q9SLQ0_ORYSI/194-290--------------
Q9UVC2_PASFU/52-153--------------
Q9ZPG6_ARATH/97-191--------------
Q9ZUK1_ARATH/211-302--------------
Q9FWB1_ARATH/104-198--------------
Q9HFY8_COLGL/148-252--------------

PF03564

O17518_CAEEL/85-228--------------
A7SE42_NEMVE/491-638--------------
Q17051_9BILA/155-293--------------
Q23992_DROME/160-308--------------
O16669_CAEEL/141-284--------------
A7XDH0_DROAN/157-302--------------
Q4JS97_ANOGA/133-280--------------
Q4EAY5_9RICK/161-306--------------

PF14893

MOAP1_HUMAN/1-327PEDGPAPGFLQLLV
D3ZGB3_RAT/1-321LERRP.PGFVGLLR
PNM6B_HUMAN/1-320MAGRS.PSFLEMLG
PNML1_PONAB/1-365WVSAKNPAPMRKKK
PNML1_MOUSE/1-364WASNKIPVPTRKKK
D2GZV4_AILME/1-326AAEGPAPNLFQLLV
D2I1P4_AILME/1-328LERRP.PGFVGMLR
Q5BJV6_RAT/1-329PEGSPAPGLLQLLT
F1PEY7_CANFA/1-297LERRP.PGFLGMLR
PNMA3_HUMAN/1-328QRRKP.PGFLALVK
PNMA5_MOUSE/1-324QQGCP.PTFLELMK
PN6BL_HUMAN/1-327LEKRP.PGFLGLLR
PNMA5_HUMAN/1-323QRGCP.PNFLELMK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window