Sequence alignment for CL0527

PF12701

E1BEA2_BOVIN/1-82---..MATDWL-------GSIVSINCGD--SLGVYQGR.VSAVDQ...V-----------SQT.......ISL-TR....
B9PHG6_TOXGO/24-126---PGAELPYL-------GSRISLISNT--E.IRYEGI.LDSINA...E-----------QAT.......VAL-RM....
Q7QBK6_ANOGA/1-83---..MADKWV-------GKSVSIHCRN--D.IGIFQG.IIKRVT....-----------PSV.......VVI-TK....
E7M179_YEASV/1-93---...MSQYI-------GKTISLISVT--D.NRYVGL.LEDIDS...E-----------KGT.......VTL-KE....
SUM2_SCHPO/1-101---...MTEFI-------GSRISLISKS--D.IRYVGI.LQDINS...Q-----------DST.......LAL-KH....
Q21740_CAEEL/1-82---..MDDKLI-------GSVISTETKD--G.NVYQGK.LTTYDT...N-----------NGN.......LTM-AN....
Q8L7G2_ARATH/21-116---QIPVEAYI-------GSFVTLIANF--D.IRYEGI.LCFLNL...Q-----------EST.......LGL-QN....
Q9FH77_ARATH/27-127---NNVGDTFI-------GSFISLISKY--E.IRYEGI.LYHLNV...Q-----------DST.......LGL-KN....
Q9ASU0_ARATH/11-112---SSAADSYV-------GSLISLTSKS--E.IRYEGI.LYNINT...D-----------ESS.......IGL-QN....
B0XR11_ASPFC/1-104---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
FBK83_ARATH/13-130---EDLVTSMI-------GKFVAVMSNN--D.IRYEGV.ISLLNL...Q-----------DSK.......LGL-QNGNNS
Q9XW17_CAEEL/1-101---MSNQTPYI-------GSKISLISKL--D.IRYEGI.LYTVDT...N-----------DST.......IAL-AK....
Q9VTZ0_DROME/1-96---MSGGLPEL-------GSKISLISKA--D.IRYEGR.LYTVDP...Q-----------ECT.......IAL-SS....
Q5TBQ1_HUMAN/3-100---GSSGTPYL-------GSKISLISKA--Q.IRYEGI.LYTIDT...D-----------NST.......VAL-AK....
D3Z845_RAT/1-98---MSGGTPYI-------GSKISLISKA--E.IRYEGI.LYTIDT...E-----------NST.......VAL-AK....
Q873J2_NEUCS/1-101---...MSEFL-------GSRISLISRS--D.IRYVGT.LHNINS...E-----------EST.......VSL-EN....
Q8IK89_PLAF7/3-96---SVSTLPYI-------GSKISLISNS--E.IRYEGI.LYTINT...H-----------EST.......VAL-QN....
LSM14_PLEWA/1-98---MSGGTPYI-------GSKISLISKA--E.IRYEGI.LYTIDT...E-----------NST.......VVL-AK....
EDC3_PONAB/1-82---..MATDWL-------GSIVSINCGD--S.LGVYQG.RVSAVD...Q-----------VSQ.......TIS-LT....
C6TP77_DROME/2-85---GPTDQDWI-------GCAVSIACDE--V.LGVFQG.LIKQIS....-----------.AE.......EIT-IV....
A8XFX5_CAEBR/1-80---..MDDKHI-------GSVISAETKD--G.SVYQGK.LTTLDT...H-----------NGN.......ITM-AN....
E1ZRD6_CHLVA/11-105---GGDGLPFI-------GSLMRLISSG--D.VAYQGI.LWSIDM...P-----------NST.......IAL-SN....
D8LRU5_ECTSI/4-98---EGSGVPLV-------GSRISLISKK--N.IRYEGT.LYNINT...S-----------DAS.......LAL-QN....
D7FK17_ECTSI/1-95---..MSGDLV-------GSRISLISRK--D.IRWEGI.LVQVDR...E-----------NAS.......VTL-QN....
EDC3_MACFA/1-82---..MAADWL-------GSIVSINCGD--S.LGVYQG.RVSAVD...Q-----------VSQ.......TIS-LT....
F1SIE7_PIG/1-82---..MATDWL-------GSIVSINCGD--S.LGVYQG.RVSAVD...Q-----------VSQ.......TIS-LT....
D2HKY7_AILME/1-82---..MATDWL-------GSIVSINCGD--S.LGVYQG.RVSAVD...Q-----------ISQ.......TIS-LT....
B3M4J7_DROAN/2-85---GLTDQDWI-------GCAVSIACDD--D.LGVFQG.LIKQIS....-----------.AE.......EIT-IV....
B3NHU0_DROER/2-85---GPTDQDWI-------GCAVSIACDE--V.LGVFQG.LIKQIS....-----------.AE.......EIT-IV....
B4QNW4_DROSI/2-85---GPTDQDWI-------GCAVSIACDE--V.LGVFQG.LIKQIS....-----------.AE.......EIT-IV....
Q54U48_DICDI/1-94---..MATPYI-------GAKIVLISKS--L.VKYEGI.LYTIDP...K-----------DNT.......LSL-KN....
E3LVA9_CAERE/2-84---VNMDDKHI-------GSVISAETND--G.SVYQGK.LTTLDA...H-----------NGN.......VTM-AN....
D8MAI5_BLAHO/3-100---TNSSSQYI-------GKIASLISTA--N.IRYEGT.IYMINN....-----------.DT.......ITL-KN....
E3QL85_COLGM/1-101---...MSEFL-------GSRISLISKS--D.IRYVGV.LHEINS...D-----------EST.......VSL-EN....
D2VFF0_NAEGR/15-110---QPQGTPYV-------GSKISLISKS--D.IRYEGI.LYNVDT...V-----------SST.......VAL-RD....
A4S925_OSTLU/1-101---..MDGSFI-------GSTIYLVSHS--D.IRYEGV.LVNIDP...V-----------EST.......LTL-QN....
Q4UE88_THEAN/1-98---.MSIEPFI-------GTKISLISKV--G.IRYEGS.LHSLNT...D-----------DST.......IVL-KD....
F2PMZ7_TRIEC/1-104---.MDMNNFI-------GRRFNLISMS--D.IRYVGT.LHDINP...E-----------AST.......IAL-EN....
C5FH61_ARTOC/1-104---.MEMNNFI-------GRRFNLVSMS--D.IRYVGT.LHDINP...E-----------AST.......IAL-EN....
F2SZB8_TRIRC/1-104---.MDMNNFI-------GRRFNLISMS--D.IRYVGT.LHDINP...E-----------AST.......IAL-EN....
B2B0J3_PODAN/1-101---...MSDYI-------GSRISLISKS--D.IRYVGT.LASINS...D-----------DST.......VSL-EN....
A9TBA5_PHYPA/7-110---PNTADSYI-------GSLISLTSKS--E.IRYEGI.LYTVDT...E-----------NSN.......IAL-QN....
D8SR19_SELML/17-118---SANFDSYI-------GSLISLTSKS--D.IRYEGV.LYTIDA...E-----------NCN.......IAL-QN....
E4ZQE4_LEPMJ/1-98---...MSEFI-------GSRISLISKS--D.IRYVGT.LVDINS...E-----------AST.......VSL-DN....
E3RJ42_PYRTT/1-98---...MSEFI-------GSRISLISKS--D.IRYVGT.LVEINS...E-----------AST.......VSL-DN....
B2W2Z3_PYRTR/1-98---...MSEFI-------GSRISLISKS--D.IRYVGT.LVEINS...E-----------AST.......VSL-DN....
B9N0P5_POPTR/10-110---SKAGESYI-------GSLISITSKY--E.IRYEGV.LYHINP...Q-----------DAT.......IGL-KN....
B9HIX6_POPTR/10-110---NSTADSYI-------GSLISLTSKS--E.IRYEGI.LYNINT...E-----------ESS.......IGL-KN....
Q9AV95_SOYBN/10-110---SSAADSYI-------GSLISLTSKS--E.IRYEGI.LYNINT...E-----------ESS.......IGL-RN....
B9HWN3_POPTR/17-117---SSTADSYV-------GSLISLTSKS--E.IRYEGI.LYNINT...D-----------ESS.......IGL-KN....
C5Z2C6_SORBI/6-105---AAAPESYI-------GSLISLMSKS--E.IRYEGV.LYTINT...E-----------ESS.......IGL-RN....
B9S1S4_RICCO/7-107---SKAGESYL-------GSYISLISKY--E.IRYEGI.LYHLNV...Q-----------DST.......IAL-KN....
B9SEH0_RICCO/16-118---NSTADSYI-------GSLISLTSKS--E.IRYEGV.LYNINT...E-----------ESS.......IGL-KN....
C0P9P8_MAIZE/9-108---AAAPESYI-------GSLISLMSKS--E.IRYEGV.LYTINT...E-----------ESS.......IGL-KN....
F2CV11_HORVD/7-106---AAAPETYI-------GSVISLTSKS--E.IRYEGV.LYTINT...E-----------ESS.......IGL-RN....
C5XEW0_SORBI/33-136---AGSAESYI-------GSLISLTSKS--E.IRYEGV.LYNINT...E-----------ESS.......IGL-RN....
B9FTF3_ORYSJ/4-103---AAAPESYI-------GSVISLTSKS--E.IRYEGV.LYTINT...E-----------ESS.......IGL-RN....
D7KQT8_ARALL/11-112---SSAADSYV-------GSLISLTSKS--E.IRYEGI.LYNINT...D-----------ESS.......IGL-QN....
Q657T0_ORYSJ/29-132---AASPDSYI-------GSLISLTSKS--E.IRYEGI.LYNINT...E-----------ESS.......IGL-RN....
B9SIZ7_RICCO/18-118---GGSGDSYI-------GSLISLTSKS--E.IRYEGV.LYNINT...Q-----------EST.......IGL-RN....
B8B2T9_ORYSI/2-101---AAAPESYI-------GSVISLTSKS--E.IRYEGV.LYTINT...E-----------ESS.......IGL-RN....
B9N200_POPTR/18-118---GASADSYV-------GSLISLTSKS--E.IRYEGV.LFNIDT...Q-----------EST.......IGL-RN....
B9H3R0_POPTR/25-125---GSSADSYV-------GSLISLTSKS--E.IRYEGV.LFNINT...Q-----------EST.......IGL-RN....
B6K0S5_SCHJY/1-100---...MTEFI-------GSRISLISKS--D.IRYVGI.LQDINS...R-----------EST.......LTL-KN....
A8X5I4_CAEBR/1-101---MSNQTPYI-------GSKISLISKL--D.IRYEGI.LYTVDT...N-----------DST.......IAL-AK....
B2ZCP0_CAEBE/2-102---SSSQTPYI-------GSKISLISKL--D.IRYEGI.LYTVDT...N-----------DAT.......IAL-AK....
E2F3W7_SCHMD/1-98---.MNGQAFL-------GCKISLISRA--G.IRYEGI.LYTIDA...N-----------NST.......VAL-SK....
E4UT72_ARTGP/1-104---.MDMNNFI-------GRRFNLISMS--D.IRYVGT.LHDINP...E-----------AST.......IAL-EN....
E1G1X5_LOALO/1-102---MAQQTPYI-------GSRISLISKL--D.IRYEGI.LYTVDT...N-----------EST.......IAL-AK....
C1GYA0_PARBA/1-104---.MDMNHFI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------DST.......IAL-EN....
C0NK89_AJECG/1-104---.MDMNHFI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------DST.......IAL-EN....
A6RQW3_BOTFB/1-101---...MSEFI-------GSRISLVSKS--D.IRYVGT.LHEINS...E-----------NAT.......VAL-EN....
C8VTV1_EMENI/1-104---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-QN....
Q0D0U7_ASPTN/1-103---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
B6QIP7_PENMQ/1-103---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
A1D2I3_NEOFI/1-104---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
B8MJZ3_TALSN/1-103---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
A1CPM4_ASPCL/1-104---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
E9DIB2_COCPS/1-102---...MNHFI-------GRRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
D5G7H6_TUBMM/1-99---...MSEFI-------GSRISLISRS--D.IRYVGR.LHDINS...E-----------NHT.......VAL-EQ....
Q2UNT4_ASPOR/1-104---.MDMNHLI-------GQRFNLISKS--D.IRYVGT.LHEINP...E-----------AST.......IAL-EN....
E4X6L1_OIKDI/3-98---GPGDTPYL-------GSRISLISKA--K.IRYEGI.LYAIDT...E-----------NMT.......VAL-TK....
Q5CK91_CRYHO/1-96---..MVHEYI-------GSKITIISRN--D.KRYEGV.LHSIDV...D-----------KST.......ITL-KD....
F1LC23_ASCSU/24-125---MSEQMSYI-------GCKLSLLSNM--D.VRYEGI.LCAVNI...E-----------ECS.......VAL-TK....
E5SSZ2_TRISP/1-100---..MNAPLL-------GSKISLISKS--E.IRYEGI.LYTVDP...E-----------QSS.......IAL-AK....
F1L7R2_ASCSU/24-125---STQQTPYI-------GSKISLISKL--D.IRYEGI.LYTVDT...N-----------EST.......IAL-AK....
E3KKB4_PUCGT/1-103---..MAQQYI-------GSRISLISKS--D.IRYRGI.LHSIDP...A-----------AST.......VSL-EQ....
B4IX73_DROGR/1-96---MSGGLPEL-------GSKISLISKA--D.IRYEGR.LYTVDP...Q-----------ECT.......IAL-SS....
B4N336_DROWI/2-97---SGGGLPEL-------GSKISLISKA--D.IRYEGR.LYTVDP...Q-----------ECT.......IAL-SS....
B3NHB8_DROER/1-96---MSGGLPEL-------GSKISLISKA--D.IRYEGR.LYTVDP...Q-----------ECT.......IAL-SS....
D6WGE3_TRICA/1-95---MSAGMPEI-------GSKISLISKA--D.IRYEGR.LFTVDP...K-----------ECT.......IAL-SS....
Q7PTC4_ANOGA/1-90---....MPEI-------GSCISLISKA--D.IRYEGL.LFTVDP...E-----------RCT.......IAL-AR....
Q16NS4_AEDAE/1-94---MSCPMPEI-------GSCISLISKA--D.IRYEGL.LFTVDP...D-----------RCT.......IAL-AR....
E3X8Q0_ANODA/1-93---MSCPMPEI-------GSCISLISKA--D.IRYEGL.LFTVDP...E-----------RCT.......IAL-AR....
A8NDX3_COPC7/1-99---..MALSFI-------GKTISLISHS--D.VRYRGI.LAGIDP...Q-----------AST.......ISL-QN....
E9E117_METAQ/1-101---...MSEFL-------GSRISLISKS--D.IRYVGT.LHEINS...D-----------EST.......VSL-EN....
F0VJJ4_NEOCL/27-129---PGAELPYL-------GSRISLISNT--E.IRYEGI.LDSINA...E-----------QAT.......VAL-RM....
F1L295_ASCSU/3-104---TARQAPYV-------GSKLSLVSKQ--G.IRYEGT.LYTVDP...T-----------AST.......IAL-SD....
A4I195_LEIIN/1-95---...MQNSV-------GDVINLISKS--E.IRYEGQ.LHSINT...E-----------ENT.......VSL-SN....
Q4QA41_LEIMA/1-95---...MQNSV-------GDVINLISKS--E.IRYEGK.LHSINT...E-----------ENT.......VSL-SN....
A4HEG4_LEIBR/1-95---...MHNAV-------GDRINLISKS--E.IRYEGH.LHSINT...D-----------ENT.......VSL-SN....
E9AXD1_LEIMU/1-95---...MQNSV-------GDVINLISKS--E.IRYEGQ.LHSINT...E-----------ENT.......VSL-SN....
F0X7G9_GROCL/1-101---...MSEFL-------GARISLISKS--D.IRYSGV.LHEINS...E-----------EST.......VSL-EN....
C9SLB1_VERA1/1-101---...MSEFL-------GSRISLISKS--D.IRYVGV.LHEINS...D-----------EST.......VSL-EN....
E0VL61_PEDHC/1-93---MSAQMPEL-------GSKITLISKA--D.IRYEGR.LFTVDP...Q-----------ECT.......IAL-AN....
F0J935_AMBVA/1-102---MSTGIPYL-------GSKISLISKS--E.IRYEGI.LYTIDT...K-----------EST.......VAL-AK....
E9GNF0_DAPPU/1-102---MSKAMQLL-------GSKISLISKS--E.IRYEGI.LFTLNP...N-----------EST.......LAL-AK....
E2A710_CAMFO/1-95---MSGGMPEL-------GSKISLISKA--D.IRYEGR.LFTVDP...Q-----------ECT.......IAL-AN....
Q4S5K0_TETNG/1-97---.SSAKPYI-------GCKIGLISKA--Q.NRYEGI.LYTIDK...V-----------NST.......VVL-AK....
F1QIF2_DANRE/1-98---MSGGTPYI-------GSKISLISKA--E.IRYEGI.LYTIDT...E-----------NST.......VAL-AK....
LS14B_XENTR/1-98---MSSGTPYI-------GSKISLISKA--Q.IRYEGI.LYTIDT...E-----------NST.......VAL-AK....
Q4TCT1_TETNG/3-100---AGGGTPYI-------GSKISLISKA--Q.IRYEGI.LSSVDT...E-----------RST.......IAL-AK....
Q6P0B2_DANRE/1-98---MSGGTPYI-------GSKISLISKA--E.IRYEGV.LYTIDT...E-----------NST.......VAL-AK....
L14BB_XENLA/1-98---MSSGTPYI-------GSKISLISKA--Q.IRYEGI.LYTIDT...E-----------NST.......VAL-AK....
D2HE65_AILME/3-107---GSSGTPYL-------GSKISLISKA--Q.IRYEGI.LYTIDT...D-----------NSTDDNLTLLSLN-SE....
D3ZU15_RAT/3-100---GSSGTPYL-------GSKISLISKA--Q.IRYEGI.LYTIDT...D-----------NST.......VAL-AK....
Q4SDR1_TETNG/2-99---SGGGTPYI-------GSKISLVSKA--E.IRYEGI.LYTIDT...E-----------NST.......VAL-AK....
A8E579_DANRE/1-98---MSSGTPYI-------GSKISLISKA--Q.IRYEGI.LYTIDT...D-----------NST.......VAL-AK....
E6ZFT9_DICLA/3-100---SGGGTPYI-------GSKISLISKA--Q.IRYEGI.LSSVDT...D-----------RST.......VAL-AK....
E9CGL0_CAPO3/1-100---..MTAPYI-------GSRISLISNA--N.IRYEGT.LYGINT...E-----------EST.......VTL-AN....
C3XU47_BRAFL/1-99---MSGGTPYL-------GSKISLISKA--N.IRYEGI.LYTIDT...K-----------EAT.......VAL-AK....
Q4XSD8_PLACH/3-96---SVSTLPYI-------GSKISLISNS--E.IRYEGI.LYTINT...H-----------EST.......VAL-QN....
Q7RRL5_PLAYO/3-96---SVSTLPYI-------GSKISLISNS--E.IRYEGI.LYTINT...H-----------EST.......VAL-QN....
B3LA44_PLAKH/3-96---SVSTLPYI-------GSKISLISNS--E.IRYEGI.LYTINT...H-----------EST.......VAL-QN....
A5K436_PLAVS/3-96---SVSTLPYI-------GSKISLISNS--E.IRYEGI.LYTINT...H-----------EST.......VAL-QN....
C5L0T8_PERM5/2-98---SGSSLPYI-------GSRISLISNA--E.IRYEGI.LYTINT...E-----------EST.......IAL-QN....
C5KQI2_PERM5/2-98---SGSSLPYI-------GSKISLISNA--E.IRYEGI.LYTINT...E-----------EST.......IAL-QN....
C5LVV7_PERM5/2-98---SGSSLPYI-------GSKISLVSNA--G.IRYEGI.LYTINT...E-----------EST.......IAL-QN....
B3S6N3_TRIAD/3-104---SSDTTPYI-------GSKISLISKA--Q.IRYEGT.LSAIDT...N-----------EST.......VHL-SD....
E6ZRW2_SPORE/1-98---.MATAEYI-------GALISLVSKS--D.IRYQGL.LASINP...E-----------QAT.......IAL-EK....
Q4P2V7_USTMA/1-99---.MATAEYI-------GALISLVSKS--D.IRYQGL.LASINP...N-----------EAT.......IAL-ER....
B4N6E7_DROWI/3-89---LTDQQDWI-------GCAVSITCDE--F.LGVFQG.LIKQIS....-----------.AE.......EIT-IV....
B0DQA2_LACBS/1-98---..MALSFI-------GKPISLISHS--D.VRYRGI.LAGIDP...A-----------AST.......IQL-SN....
Q4E1M8_TRYCC/1-97---.MSAERAI-------GSTITLITNS--L.IRYEGT.LGQIDG...P-----------NNT.......VSL-TN....
D0A5I6_TRYB9/1-97---.MAATRAI-------GSTITLITNS--Q.IRYEGT.LGHIDA...S-----------KNT.......VSL-TN....
Q22BP4_TETTS/1-97---.MDAVQML-------SKKIQIITKS--K.IRYEGE.IFKIDT...A-----------NST.......IAL-KN....
B4J3I1_DROGR/2-86---GLTDQDWI-------GSAVSLTCDD--E.LGIFQG.LIKKIS....-----------.AE.......EIT-IV....
B4LF03_DROVI/2-86---GLTDQDWI-------GSAVSLTCDD--E.LGVFQG.LIKKIS....-----------.AD.......EIT-IV....
B4KZK2_DROMO/2-86---GLTDQDWI-------GCAVSLTCDD--E.LGVFQG.LIKKIS....-----------.AE.......EIT-IV....
B4HBW0_DROPE/2-88---GLTDQDWI-------GCAVSITCDE--V.LGVFQG.LIKQIS....-----------.AE.......EIT-IV....
A3LQK8_PICST/1-98---...MSQYI-------GKTISLISNK--G.LRYVGL.LDNINA...D-----------DAT.......VAL-KS....
C1FHK0_MICSR/1-99---MAQAQQYI-------GSKISLISKS--E.IRYEGI.LHDINN...V-----------DSS.......LTV-QN....
D7MU39_ARALL/27-127---NDVGDTFI-------GSFISLISKY--E.IRYEGI.LYHLNV...Q-----------DST.......LGL-QN....
F1M7Z1_RAT/1-82---..EAMDWL-------GSIVSINCGD--S.LGVYQG.RVSAVD...Q-----------VSQ.......TIS-LT....
A0ELI5_MOUSE/1-82---..MAMDWL-------GSIVSINCGD--S.LGVYQG.RVSAVD...Q-----------VSQ.......TIS-LT....
A5DQD8_PICGU/1-101---...MSQYI-------GKTISLISNK--G.VKYVGL.LDNINA...D-----------DAT.......VAL-KS....
E0VJ09_PEDHC/1-80---...MEQFI-------GKFISLHCND--P.LGVFQGQIVHIDP...T-----------DQK.......ITL-EK....
B6AJV5_CRYMR/1-92---..MVHEYI-------GSKITIISRN--E.NRYEGI.LHSIDV...D-----------EST.......ITL-KD....
Q5BZX0_SCHJA/2-99---NASDLSFI-------GCRVSIVSKA--K.IRYEGN.LHSIDLDTPN-----------EPV.......ITL-SK....
Q6CVK7_KLULA/1-94---...MSQYI-------GKTIALISNT--D.NRYVGL.LESIDS...E-----------KGV.......VTL-RQ....
Q2LYI8_DROPS/4-85---..TDQDWI-------GCAVSITCDE--VLGVFQGL.IKQI.....S-----------AEE.......ITI-VR....
EDC3_HUMAN/1-81---..MATDWL-------GSIVSINCGD--SLGVYQGR.VSAVDQ...V-----------SQT.......ISL-TR....
EDC3_XENLA/1-81---..MAADWL-------GSIVSINCGN--TLGVYQGC.VSAVDR...I-----------NQT.......ISL-SQ....
Q4RS95_TETNG/1-80---..MASDWL-------GSLVSINCGP--TLGVYQGE.VAFVDQ...T-----------SQT.......ISL-RH....
Q16Z12_AEDAE/1-80---..MSDNWI-------GKSVSIQCRE--DIGVFQGV.IKQV.....S-----------PAE.......IVI-TK....
EDC3_DANRE/1-83---..MALDWV-------GNLVSIHCGP--TLGVYQGE.ISSVDQ...T-----------SQT.......ISL-RN....

PF14438

Q5BDQ5_EMENI/104-178DRLVFLFTTFI-------GLSTTVTTKN--GDQ.FTGI-LSSSTL---EPN.........ESS-------VTL.KM----
D8SR19_SELML/21-91D.......SYI-------GSLISLTSKS--DIR.YEGV-LYTIDA---E...........NCN-------IAL.QN----
Q93V36_ARATH/25-99EALLISTMCII-------GLQVHVHIND--GSV.FSGI-FYTVSL---EN..........EFS-------IVL.KN----
A9TXE8_PHYPA/155-235DRLVYMYTCLI-------GQHVDVQRID--GHV.YSGI-FHAASF---EK..........EIG-------VIL.KM----
Q4RG15_TETNG/9-83ARMLHFLTAVV-------GSTCDIRVKN--GNV.FEGI-FKTLSS---............RCE-------LAV.DA----
B4PRP5_DROYA/59-128TFFMHSATALV-------GSVVEVRLRS--GNI.YEGV-FRTFSG---............NFD-------IAL.EL----
E9BAG4_LEIDB/11-89DRLEYLYLNLV-------GQTVLIHTVD--GAL.CEGL-FVSRTD---ADVA......ADEAG-------VFI.SF----
D3BPE8_POLPA/83-156ERTVFMSMNLI-------GHHVAVQLKN--GDC.YEGI-LTSTNT---SQV.........GWG-------CAL.KF----
A8QGL3_BRUMA/12-97QELLVLITKMI-------GKEVLLETRD--GLT.FEGI-FAGCSP---DVATLLDVSDNLQFD-------VGL.RY----
D0MVB6_PHYIT/100-171HRALFAFRFLV-------GKAVELQLVA--SDDRYVGI-LDCVDP---D...........DFS-------VVL.KS----
D2A4A5_TRICA/121-194AHFMHSATLQI-------GNVVRIKTAS--GVV.WEGV-FKTFSS---............NFD-------VVL.EV----
E9CID8_CAPO3/95-174DRIAHFSSCLT-------GLPVYVRTKT--.QI.YYGV-LVSTTS---EKA.........GLA-------VSL.RA----
E2AAH8_CAMFO/34-101AHFMHAITGHV-------GNVVQIQTQN--GSI.YEGI-FRTFSS---............NFD-------VVL.EM----
Q0USK0_PHANO/103-187DRMMYLLANLT-------GLPGIITLKN--GEK.YSGV-LSGTSL---DPS.........ELR-------YVF.KM----
Q01A57_OSTTA/7-78ERGAFARHILR-------GHRVEVRTVD--GTT.HEGV-LAKADA---E...........AWT-------IAY.AW----
Q4D0Q9_TRYCC/10-88DRLEYLYLNLV-------GQVVQVRLVD--GSS.LEGI-FVSRTD---VDAD.......TEAG-------ILL.CC----
E9QQ61_MOUSE/236-307VRMVHILTSVV-------GSKCEVQVKN--GGI.YEGV-FKTYSP---............KCD-------LVL.DA----
A7SAG3_NEMVE/46-125PCFVHAVTSLI-------GCHVQLTAVN--GSV.YDGI-LRTVSP---............KVE-------VVL.DV----
Q6FVS9_CANGA/40-117DRLDYLLVNGI-------GSNVKVTTTA--GIQ.YEGV-LAAANT---EST........NGID-------VVL.KH----
E9GS99_DAPPU/50-121LRFCETITSLM-------GNTVQIQLSN--GKI.FEGI-FSTFSP---............QLE-------VVL.EL----
A9V850_MONBE/3-84DLLKFAACTMV-------GLPIQVQTKS--GLV.YQGV-LNAINV---AD..........DFG-------VSL.CH----
B5YMG3_THAPS/153-230ERFLHLCLSMV-------GQTVTLTQTD--GTI.LEGV-FHTFAP---FANQP....KHIRNT-------YVV.KA----
D8TQ60_VOLCA/53-130DRLGFIGNVLI-------GYKVEAQVSS--GMV.YEGV-FGSLHN---DST.........GVS-------FIL.KY----
B0XQ85_ASPFC/25-109DRLIFLLTSFI-------GLDATITTRS--GER.FTGI-FSSSSL---EPH.........DSS-------ILL.KM----
A2CF31_DANRE/61-132MRMVHVLTSVV-------GTKCELKVKN--GLI.YEGV-FKTYGP---............ECD-------IVL.DA----
C1N5K5_MICPC/11-96ERLAFVSQVLV-------GYQVEVALTN--GAV.YEGV-FHAGSP---SDDKW....EKNDFK-------IVL.KM----
Q8ILA7_PLAF7/22-97DRLSYVMTCLL-------GNEVNVYMKD--GKE.IRGL-FHAYNL---TAKND.....KKEID-------ISL.NH----
A8NUD4_COPC7/90-158DRVLQSLAGLT-------GMTVTLLTKT--GQR.YEGT-VSSTSN---EGD.........TTG-------VTL.KD----
ATX2_DICDI/83-159ERTVFMSMSLV-------GQNVSVTLKN--GDV.YEGI-LHTTST---STGSS.....GGGWG-------VAL.KM----
F0ZSI7_DICPU/73-152ERTVYMSMSLV-------GQVISVTLKN--GDI.YEGI-LSSTQT---NTAGDK..GGSGGWG-------LVL.RM----
Q8RY61_ARATH/21-95SVLIAATMCII-------GLQVHVHVKD--GSV.FSGI-FFTASV---DN..........GFG-------IVL.KD----
D2V0R5_NAEGR/134-205KRMFFLFLNFV-------GHVVEIVNVS--GEV.YEGI-FHTAKA---DSLN.......DDFV-------FVL.TL----
Q94AM9_ARATH/47-126DRLVYFTTCKI-------GHHVEVHLRN--GSV.YTGI-FHAANV---EK..........DFG-------IIL.KM----
B1Y929_THENV/10-78KRFVAELNNLI-------GREVQVVLSN--GEV.YRGV-LHAVDN---............QLN-------IVLANA----
D7FVW6_ECTSI/93-178DRWMNVTKTMM-------GERAEITTTS--GCV.YEGV-FHVLTP---GEEPRPG.AKRGMYR-------VIM.RA----
Q6PFI6_DANRE/39-119SRMLHFLTAVV-------GSRCDVMVKN--GSL.YEGI-FKTLSS---............RCE-------LAV.DA----
D8RJA7_SELML/76-157GRLLYLTMCLV-------GQFVEVQLKD--GSV.FSGI-FHTANM---DK..........DFG-------VVL.KM----
Q9P3K1_NEUCS/92-165DKKSVTSSLRE-------GQRVRITLAN--GSE.FEGT-YANTQD---PN..........TCR-------LTT.VT----
B9PGS2_TOXGO/32-107LRLNYCMAVLA-------GREVRVNLEN--GGR.VQGL-FHAYEK---KDRKD.....GQEGS-------LVL.SC----
A8JCT6_CHLRE/51-129DRLGFIGNVLI-------GYRVEVQVAS--GVV.YEGV-FGSLQN---DGS.........GVS-------VVL.KF----
C9JXV8_HUMAN/121-192SRMLHFLTAVV-------GSTCDVKVKN--GTT.YEGI-FKTLSS---............KFE-------LAV.DA----
Q8L793_ARATH/50-125KLLVYFTTCNI-------GHQVEVHLKN--GSV.YSGI-FHAANV---EK..........DFG-------IIL.KM----
Q6BJB7_DEBHA/52-137DKLLHLVAKSI-------GKKCIVTVSS--GAR.YQGL-LVSADL---SSQQGQ..DVSSPLS-------IVL.QS----
E4XJQ7_OIKDI/47-119QSLCHALTALV-------GTKCEVRVRN--PNVTHEGF-FNTFSS---............DMD-------FAV.SA----
Q6CJX9_KLULA/42-121ERQDFLLVNGI-------GNRAIVTITS--GVK.YEGL-VAAWNP---HSSG.......KGIG-------VVL.KY----
Q4PB76_USTMA/116-192DRMVFLLVTLV-------GNPVTVTVKG--GSS.FFGI-FSAANT---EGG.........ELS-------VALASA----
B3RJZ6_TRIAD/63-136AHFTYHVTSLM-------GVLVRVVVTN--GNM.FEGI-LRSCSP---............KAD-------IVL.NA----
A3LNE7_PICST/2-83NRLLYLVTKSI-------GKSCVATITN--GAR.YQGL-LVSADL---SPTG......SSALS-------VVL.MN----
C4YPF0_CANAW/21-94KRLVYLTSKAM-------GKKCIATITD--GSR.YQGL-LVGSDL---S...........PLS-------VVL.LK----
Q75F67_ASHGO/41-119DRMNYVLVNSI-------GGRAVVTIPS--GVK.YSGM-LLACNA---TTS........NGVD-------VIL.KY----
B7FW14_PHATC/78-161ERYLGLCLNLV-------GHKVVVHLRD--GRQ.LEGI-FHTATS---FASID....AKLRNQ-------YVL.KG----
E7KCP4_YEASA/50-127DRQDYLLANSI-------GSDVTVTVTS--GVK.YTGL-LVSCNL---EST........NGID-------VVL.RF----

PF01423

Q9GP42_ECHMU/11-76----DFLKLII.......GRPVVVKLNS..G.ADYRGV-LISLDG---------------YMN-------VVL-EQ----
Q8MRZ3_DROME/144-252----NESNERI.......RVRVVIRKHGSVG.GSVEGE-LLAFDK---------------QWN-------LLL-RN----
LSM3_MOUSE/19-97----DLIRLSL.......DERIYVKMRN..D.RELRGR-LHAYDQ---------------HLN-------MIL-GD----
RSMB_SCHPO/4-80----TKMVSLL.......NHSLNVTTKD..G.RTFVGQ-LLAFDG---------------FMN-------LVL-SD----
SMD3_MOUSE/8-73----KVLHEAE.......GHIVTCETNT..G.EVYRGK-LIEAED---------------NMN-------CQM-SN----
Q9AVY1_GUITH/10-75----KFLKE.........KNLVTIIFKGSND.YILEGN-LIGFDE---------------FMN-------LVI-EN----
RSMB_DROME/7-82----NKMIQHL.......NYRVRIVLQD..S.RTFIGT-FKAFDK---------------HMN-------LIL-GD----
RUXE_CAEEL/19-85----RYLQNRT.......RVQIWLYEDV..T.HRLEGY-IIGFDE---------------FMN-------VVF-DE----
Q9C2A8_NEUCS/10-75----KLLNEAQ.......GHIVTLEITS..G.QTYRGK-LIEAED---------------NMN-------VQL-KD----
Q95XN6_CAEEL/9-74----EFLKKVI.......GKPVVVKLNS..G.VDYRGI-LACLDG---------------YMN-------IAL-EQ----
Q9SI54_ARATH/9-82----LDLAKFV.......DKGVQVKLTG..G.RQVTGT-LKGYDQ---------------LLN-------LVL-DE----
SMD2_SCHPO/33-111----LQQAVKN.......HDQVLINCRN..N.KKLLAR-VKAFDR---------------HSN-------MVL-EN----
HFQ_RALSO/6-65----QLLQDPFLNALRKEHVPVSIYLVN..G.IKLQGN-IESFDQ---------------YVV-------LLR-NT----
LSM5_SCHPO/9-75----ELIDKCI.......GSNLWVIMKS..E.REFAGT-LVGFDD---------------YVN-------IVL-KD----
Q9GYZ5_9TRYP/11-76----GFLQQLR.......GTQVEIEMMN..S.TIVTGE-ITFVEA---------------NMN-------TYM-RH----
RUXG_CAEEL/7-72----PELKKYM.......DKEMDLKLNG..N.RRVSGI-LRGFDP---------------FMN-------MVI-DE----
SMD3_SCHPO/6-71----KLLHETQ.......GHIVTMELEN..G.STYRGK-LIEAED---------------NMN-------CQM-RD----
RUXF_MOUSE/9-74----PFLNGLT.......GKPVMVKLKW..G.MEYKGY-LVSVDG---------------YMN-------MQL-AN----
RUXG_MOUSE/7-72----PELKKFM.......DKKLSLKLNG..G.RHVQGI-LRGFDP---------------FMN-------LVI-DE----
Q8PUF1_METMA/5-71----KKVQKIV.......GSRIQVEMKG..DLNLLEGT-LKSVDD---------------YMN-------LHL-VD----
Q98RT8_GUITH/8-71----VEISNFI.......QKKVNVILIN..Q.INLKGT-LVGFDN---------------FSN-------IVI-KK----
Q8TZN2_PYRFU/4-70----ESLLEKVLKEWK..GHKVAVSVGG..D.HSFTGT-LEDFDE---------------EV.-------ILL-KD----
RUXE_MOUSE/23-89----RYLQNRS.......RIQVWLYEQV..N.MRIEGC-IIGFDE---------------YMN-------LVL-DD----
O18694_CAEEL/16-84----ELIDKCI.......GSKIWVIMKN..D.KEIVGT-LTGFDD---------------YVN-------MVL-ED----
Q98S70_GUITH/5-70----NFIKQLK.......GEEIIIELKN..N.IIIMGV-IVNVDK---------------NMN-------LKV-SN----
RUXG_SCHPO/7-72----PDLKKYL.......DRQVFVQLNG..S.RKVYGV-LRGYDI---------------FLN-------IVL-ED----
LSM2_SCHPO/5-72----SFFKTLI.......DTEVTVELKN..D.MSIRGI-LKSVDQ---------------FLN-------VKL-EN----
LSM6_SCHPO/7-72----EFLNKVI.......GKKVLIRLSS..G.VDYKGI-LSCLDG---------------YMN-------LAL-ER----
HFQ_BACSU/4-64----INIQDQFLNQIRKENTYVTVFLLN..G.FQLRGQ-VKGFDN---------------FTV-------LLE-SE----
O27489_METTH/12-66----KQFLKFK.......NKNVLLTLKN..N.EETRGK-LISIDN---------------YLN-------TVL-QT----
LSM4_YEAST/5-81----YLLTNAK.......GQQMQIELKN..G.EIIQGI-LTNVDN---------------WMN-------LTL-SN----
Q9U7L5_9TRYP/25-91----KFMTTQQ.......RVCVWLVHDA..H.IKIEGN-LLGYDE---------------FMN-------VVL-GD----
Q9VTW6_DROME/5-72----SFFKSLV.......GKEVVVELKN..D.LSICGT-LHSVDQ---------------YLN-------IKL-TD----
RUXF_SCHPO/10-75----PFLQGLI.......GKPVLVRLKW..G.QEYKGT-LQSVDS---------------YMN-------LQL-LN----
LSM4_SCHPO/5-71----TLLNATQ.......GRPILVELKN..G.ETFNGH-LENCDN---------------YMN-------LTL-RE----
HFQ_CLOPE/6-66----NNLQDIFLNNARKERIPVTIFLVN..G.VQLKGI-VKGFDS---------------FTV-------VLD-SD----
Q8RMG6_GLUDI/7-67----QNVQDVFLNHVRRSKTPVTVFLVN..G.VKLQGI-ITWFDN---------------FSV-------LLR-RD----
Q8VYI0_ARATH/5-74----TGLETLV.......DQIISVITND..G.RNIVGV-LKGFDQ---------------ATN-------IIL-DE----
Q40942_BIGNA/8-70----PDLKLFM.......EEEIQIQLKN..K.LCLKGT-LRGFDQ---------------FLN-------IVL-EK----
LSM5_YEAST/10-83----EVIDKTI.......NQKVLIVLQS..N.REFEGT-LVGFDD---------------FVN-------VIL-ED----
HFQ_CLOAB/7-67----NNLQDIFLNSARKNKIPVAIHLTN..G.FQMRGS-VKGFDS---------------FTV-------ILE-SD----
LSM3_YEAST/6-78----DLLKLNL.......DERVYIKLRG..A.RTLVGT-LQAFDS---------------HCN-------IVL-SD----
RUXE_SCHPO/18-83----KLLQQHT.......PVSIWLFEQT..D.IRLQGQ-IRGFDE---------------FMN-------IVL-DD----
LSM7_SCHPO/26-98----LDLSRYQ.......DQRIQATFTG..G.RQITGI-LKGFDQ---------------LMN-------LVL-DD----
LSMH_ENCCU/6-66----CFLKMYL.......KERVEVKTKS..G.EAYTGT-LEGFDE---------------HIN-------LML-TC----
LSM1_YEAST/44-114----AAIVSSV.......DRKIFVLLRD..G.RMLFGV-LRTFDQ---------------YAN-------LIL-QD----
Q9U1W8_CAEEL/19-97----DLLRLSL.......DERVYVKMRN..D.RELRGR-LRAFDQ---------------HLN-------MVL-SE----
RUXX_ARCFU/7-72----DVLNRSL.......KSPVIVRLKG..G.REFRGT-LDGYDI---------------HMN-------LVL-LD----
SMD3_CAEEL/9-74----KILHEAE.......GHMVTLETVT..G.EVYRGK-LSEAED---------------NMN-------CQL-AE----
SMD3_YEAST/9-74----KLLNEAQ.......GHIVSLELTT..G.ATYRGK-LVESED---------------SMN-------VQL-RD----
Q9VJI7_DROME/22-96----LDLSKYL.......EKQIRVKFAG..G.REASGI-LKGYDA---------------LLN-------LVL-DN----
Q96UB4_NEUCS/9-74----ELIDKCV.......GSRIWVVMKG..D.KEFAGT-LVGFDD---------------YVN-------MVL-ED----
LSM7_YEAST/28-104----LDLAKYK.......DSKIRVKLMG..G.KLVIGV-LKGYDQ---------------LMN-------LVL-DD----
HFQ_AQUAE/3-63----YKLQESFLNTARKKRVKVSVYLVN..G.VRLQGR-IRSFDL---------------FTI-------LLE-DG----
LSM2_ENCCU/5-70----EFFRSSI.......GSRVSVMLKA..G.VYVSGR-LGGIDP---------------YLN-------LSL-LD----
Q9SSF1_ARATH/5-70----RFLMKLN.......NETVSIELKN..G.TVVHGT-ITGVDV---------------SMN-------THL-KT----
Q20229_CAEEL/12-80----ISLFEQL.......DKKLLVVLRD..G.RKLIGF-LRSIDQ---------------FAN-------LIL-ED----
RUXG_DROME/7-72----PEVKKYM.......DKRMMLKLNG..G.RAVTGI-LRGFDP---------------FMN-------VVL-DD----
RUXE_YEAST/19-92----NFLQQQT.......PVTIWLFEQI..G.IRIKGK-IVGFDE---------------FMN-------VVI-DE----
Q8KNP9_BACTI/22-77----HLLQEAF.....QKKKDITLILLK..G.LHIKGI-ITGYDT---------------FSI-------LIE-YE----
LSM6_YEAST/14-83----EFLSDII.......GKTVNVKLAS..G.LLYSGR-LESIDG---------------FMN-------VAL-SS----
RUXX_METAC/7-72----DILNNAL.......DTPVIVRLKG..A.REFRGE-LKGYDI---------------HMN-------LVL-DN----
Q8ZYG5_PYRAE/14-78----ATLQDSI.......GKQVLVKLRD..S.HEIRGI-LRSFDQ---------------HVN-------LLL-ED----
LSM1_MOUSE/8-76----ASLIEDI.......DKKHLVLLRD..G.RTLIGF-LRSIDQ---------------FAN-------LVL-HQ----
Q9HPS2_HALSA/16-69----DVLEESL.......EETVTVRLKD..G.DEFTGV-LTGYDQ---------------HMN-------VVI-EG----
RUXF_YEAST/17-83----PFLKGLV.......NHRVGVKLKF..NSTEYRGT-LVSTDN---------------YFN-------LQL-NE----
RSMB_CAEEL/7-82----NKMMAHL.......NYRMKIILQD..G.RTFIGF-FKAFDK---------------HMN-------ILL-AE----
Q979R0_THEVO/6-70----KLLEESV.......NKRVSLLLKD..N.RVLEGT-LTGYDD---------------YMN-------MVL-DD----
RUXF_NEUCR/10-76----PFLQDLV.......NSFVTIRLKW..GETEYVGR-LVSIDS---------------YMN-------IQL-SD----
Q5JI86_PYRKO/5-71----QYLLDKTLERWK..GQRVAVGIGS..E.ISFSGI-LEDFDE---------------EV.-------ILL-KN----
Q8SRW7_ENCCU/7-67----PNLASLL.......HKRIVVRIGG..G.HTLKGL-LTGYDA---------------FMN-------IVL-SE----
Q9AW42_GUITH/8-72----SILRESK.......PYVITIECKN..G.FIYRGK-LIHIEE---------------NMN-------CIL-KE----
O96265_PLAF7/22-98----LSECVKD.......NAQVLINCRN..N.RKILGR-VKAFDR---------------HCN-------LLL-TG----
LSM3_SCHPO/12-90----DLVRLSL.......DEIVYVKLRG..D.RELNGR-LHAYDE---------------HLN-------MVL-GD----
RSMB_YEAST/10-97----SRLANLI.......DYKLRVLTQD..G.RVYIGQ-LMAFDK---------------HMN-------LVL-NE----
RUXX_AERPE/11-75----RMMLDYV.......DTPVLVKLKS..G.LRIKGV-LKTYDQ---------------HLN-------IIL-GD----
Q23543_CAEEL/14-87----VDLTRFL.......DKEIRVKFQG..G.REASGV-LRGFDQ---------------LLN-------MVL-DD----
RUXX_METTH/16-81----DALGNSL.......NSPVIIKLKG..D.REFRGV-LKSFDL---------------HMN-------LVL-ND----
Q96UG3_KLULC/5-69----YLLTNAK.......GQTMHVELKN..G.ETVEGT-LSDVDN---------------WMN-------LTL-SN----
Q98S49_GUITH/5-70----NILNNNY.......NKNVFVKLKW..G.SSYTGI-FIGSDN---------------YMN-------IIL-DS----
LSM8_SCHPO/1-70----MSLADFM.......EQRVQVITND..G.RVVLGS-LKGFDH---------------TTN-------LIL-SD----
RUXX_THEAC/12-77----DVLKSAL.......SRNVLIDVKG..N.REYSGI-LEGYDV---------------YMN-------IVL-QN----
Q9FKB0_ARATH/12-80----ELIDRCI.......GSKIWVIMKG..D.KELVGI-LKGFDV---------------YVN-------MVL-ED----
RUXF_CAEEL/11-76----PFLNSLT.......GKFVVCKLKW..G.MEYKGV-LVAVDS---------------YMN-------LQL-AH----
SMD1_YEAST/5-97----NFLKKLR.......NEQVTIELKN..G.TTVWGT-LQSVSP---------------QMN-------AIL-TD----
Q97ZQ0_SULSO/10-75----KVLAESL.......NNLVLVKLKG..N.KEVRGM-LRSYDQ---------------HMN-------LVL-SD----
LSM2_YEAST/5-72----SFFKTLV.......DQEVVVELKN..D.IEIKGT-LQSVDQ---------------FLN-------LKL-DN----
RUXX_PYRAB/7-72----DVIHRSL.......DKDVLVILKK..G.FEFRGR-LIGYDI---------------HLN-------VVL-AD----
Q8LFL8_ARATH/13-81----TSLASYL.......DRKLLVLLRD..G.RKLMGT-LRSFDQ---------------FAN-------AVL-EG----
Q9CAX7_ARATH/8-72----PDLKKYM.......DKKLQIKLNA..N.RMVVGT-LRGFDQ---------------FMN-------LVV-DN----
Q8SW39_ENCCU/8-72----KLLHESQ.......GFIVTVETSS..G.DMYRGR-VREVDD---------------YMN-------LVL-DD----
SMD1_CAEEL/5-70----RFLMKLS.......HETVNIELKN..G.TQVSGT-IMGVDV---------------AMN-------THL-RA----
RUXG_YEAST/5-73----PELKKYM.......DKKILLNING..S.RKVAGI-LRGYDI---------------FLN-------VVL-DD----
LSM8_YEAST/3-66----ATLKDYL.......NKRVVIIKVD..G.ECLIAS-LNGFDK---------------NTN-------LFI-TN----
SMD2_YEAST/34-106----INDAMVT.......RTPVIISLRN..N.HKIIAR-VKAFDR---------------HCN-------MVL-EN----
RUXE_DROME/22-88----RYLQNRS.......RVQVWLYENI..S.LRIEGH-IVGFDE---------------YMN-------LVL-DD----
HFQ_THETN/8-69----INLQDIFLNQVRKEHVPVTVYLIN..G.FQLKGT-VKGFDN---------------FTV-------VLE-SE----
SMD2_CAEEL/32-111----LTNSVKN.......NHQVLINCRN..N.KKLLGR-VKAFDR---------------HCN-------MVL-EN----
Q8SSM1_ENCCU/5-65----RVLRKCK.......NERVKIETKE..G.RRIEGK-IVSVDK---------------TMN-------VEM-VD----
NAA38_HUMAN/3-72----SALENYI.......NRTVAVITSD..G.RMIVGT-LKGFDQ---------------TIN-------LIL-DE----
Q9X393_BACAN/1-61----MHTQEDFYNKLIEEQRLVTIFLIN..G.VRVPGI-IIAVDK---------------FSV-------LVS-SH----
Q9GYZ4_9TRYP/37-105----LDSAVKN.......GTRVFIQSRY..N.KSLVAT-VVAFDK---------------HFN-------LVL-RD----
LSMD1_HUMAN/43-114----QQLEALL.......NKTMRIRMTD..G.RTLVGC-FLCTDR---------------DCN-------VIL-GS----
Q92C58_LISMO/6-66----QGLQDYYLNQLRKEKILATVFLTN..G.FQLRGR-VVSFDN---------------FTV-------LLD-VE----
HFQ_BRUSU/6-66----QNLQDLFLNSVRKQKISLTIFLIN..G.VKLTGI-VTSFDN---------------FCV-------LLR-RD----
LSM5_HUMAN/16-84----ELVDKCI.......GSRIHIVMKS..D.KEIVGT-LLGFDD---------------FVN-------MVL-ED----
LSM10_MOUSE/19-84----ILLQGLQ.......GQITTVDLRD..E.SVARGR-IDNVDA---------------FMN-------IRL-AN----
LSM1_SCHPO/14-82----GSLVDYV.......DRKVIVVLRD..G.KKLIGI-LRSFDQ---------------FAN-------LML-QY----
Q95XD4_CAEEL/3-72----STLDAYM.......NRMVNVVTGD..G.RVIVGL-LKGFDQ---------------LIN-------LVI-ED----
LSM4_CAEEL/6-72----SLLKTAQ.......NHPMLVELKN..G.ETYNGH-LKACDS---------------WMN-------IHL-VD----
Q8SRU9_ENCCU/10-78----RDYEKYL.......EQEVVVMLRD..G.RYLYGV-MKSFDQ---------------FNS-------VTL-DG----
Q8SS46_ENCCU/16-80----QFLQRMK.......NRSVRVALKW..G.QVYEGT-LVASDN---------------YFN-------ILL-DE----
Q9W087_DROME/2-71----SGLESYI.......NHTVSIITAD..G.RNFIGT-LKGFDQ---------------TIN-------III-DE----
LSM7_HUMAN/13-86----LDLSKYI.......DKTIRVKFQG..G.REASGI-LKGFDP---------------LLN-------LVL-DG----
Q9M0C7_ARATH/19-85----RFLQSKA.......RIQIWLFEQK..D.LRIEGR-ITGFDE---------------YMN-------LVL-DE----
NAA38_YEAST/4-68----LKLSDFI.......GNTLIVSLTE..D.RILVGS-LVAVDA---------------QMN-------LLL-DH----
Q9GYZ7_9TRYP/8-71----AFLASLV.......GNTVHVKSKW..G.PVYVGT-LVSCDP---------------YMN-------LQL-RD----
Q9LMN4_ARATH/14-92----DLIRLSI.......EERIYVKLRS..D.RELRGK-LHAFDQ---------------HLN-------MIL-GD----
Q8TYS2_METKA/5-69----DCLRDFL.......DDIVIVELKT..G.KTLRGR-LVSFDG---------------HLN-------LVL-DD----
Q9GYZ3_9TRYP/17-83----RYLKESQ.......RVCVWLVHET..K.MKIEGV-LLGYDE---------------FMN-------VVL-GD----
O29885_ARCFU/6-72----QMVKSMV.......GKIIRVEMKG..EENQLVGK-LEGVDD---------------YMN-------LYL-TN----
Q9I9E5_DANRE/7-82----SKMLQHI.......DYRMRCILQD..G.RIFIGT-FKAFDK---------------HMN-------LIL-CD----
Q99UG9_STAAM/5-65----ENIQDKALENFKANQTEVTVFFLN..G.FQMKGV-IEEYDK---------------YVV-------SLN-SQ----
HFQ_THEMA/7-67----FNLQDRFLNHLRVNKIEVKVYLVN..G.FQTKGF-IRSFDS---------------YTV-------LLE-SG----
SMD1_SCHPO/5-70----RFLMKLT.......NETVSIELKN..G.TIVHGT-ITSVDM---------------QMN-------THL-KA----
Q8SSB9_ENCCU/5-70----TLLRISR.......NRIVELELKN..N.DQLRGL-LHKCDM---------------AMN-------LHL-KS----
Q8ZYP8_PYRAE/14-80----KVLTKML.......NKEIIARLKG..G.VAVKGV-LTAYDG---------------CMN-------LVL-ND----
Q9W2K2_DROME/11-79----AHLLEEV.......DKKLMVLLRD..G.RTLIGY-LRSVDQ---------------FAN-------LVL-QR----
Q9LM92_ARATH/10-75----KLLHEAS.......GHIVTVELKS..G.ELYRGS-MIECED---------------NWN-------CQL-ED----

PF12701

E1BEA2_BOVIN/1-82.................PFHNGV............-...-----------------------..KCL----VPEVTFRAG
B9PHG6_TOXGO/24-126.................VRSLGTEGRRHPD.....-DIP-----------------------PSPQV----YDYIVFKGS
Q7QBK6_ANOGA/1-83.................AVRNGI............-...-----------------------PLKKN----NVEVTLSAV
E7M179_YEASV/1-93.................VRCFGTEGRKNWGP...E-EIY-----------------------PNPTV----YNSVKFNGS
SUM2_SCHPO/1-101.................VRWCGTEGRKQDPS...Q-EIP-----------------------PSDNV----FDYIVFRGS
Q21740_CAEEL/1-82.................VIKNGL............-...-----------------------...PL----HRCFTLSSS
Q8L7G2_ARATH/21-116.................VVCYGTEGRNQNG....V-QIP-----------------------PDTKI----QNYILFNGN
Q9FH77_ARATH/27-127.................VRSCGTEGRKKDG....P-QIP-----------------------PCDKV----YDYILFRGS
Q9ASU0_ARATH/11-112.................VRSFGTEGRKKDG....P-QVP-----------------------PSDKV----YEYILFRGT
B0XR11_ASPFC/1-104.................VVSFGTEGRRGNPA...E-EIP-----------------------PSASV----YEYIVFRGS
FBK83_ARATH/13-130IPNPLQDLLFMIFFFSIVRVYGREVENDNEQ...R-VFQ-----------------------VLKEV----HSHMVFRGS
Q9XW17_CAEEL/1-101.................VRSFGTEKRPTAN.....-PVA-----------------------ARDDV----YEYIIFKAS
Q9VTZ0_DROME/1-96.................VRSFGTEDRDTQF.....-QIA-----------------------PQSQI----YDYILFRGS
Q5TBQ1_HUMAN/3-100.................VRSFGTEDRPTDR.....-PAP-----------------------PREEI----YEYIIFRGS
D3Z845_RAT/1-98.................VRSFGTEDRPTDR.....-PIP-----------------------PRDEV----FEYIIFRGS
Q873J2_NEUCS/1-101.................VRSFGTEGRKHNPD...E-EVP-----------------------ASDQV----YEYIVFRGS
Q8IK89_PLAF7/3-96.................VRSFGTEGR.RQP.....-DIA-----------------------PSNEV----YDFIIFRGK
LSM14_PLEWA/1-98.................FALLGTEDRPTDR.....-PIP-----------------------PRDEV----FEYIIFRGS
EDC3_PONAB/1-82.................RPFHNGVKC.........-...-----------------------....L----VPEVTFRAG
C6TP77_DROME/2-85.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLKCT
A8XFX5_CAEBR/1-80.................VIKNGL............-...-----------------------...PL----HRCATLSTS
E1ZRD6_CHLVA/11-105.................VRCFGTEGRRKEN.....-EVP-----------------------PSDQV----FEYVVFKGS
D8LRU5_ECTSI/4-98.................VRSFGTEGRVEGH.....-VIP-----------------------PSQVL----HDFVCFRGQ
D7FK17_ECTSI/1-95.................VKSWGTEGRLEGD....Q-QIP-----------------------PSDHL----HACVNFRGE
EDC3_MACFA/1-82.................RPFHNGVKC.........-...-----------------------....L----VPEVTFRAG
F1SIE7_PIG/1-82.................RPFHNGVKC.........-...-----------------------....L----VPEVTFRAG
D2HKY7_AILME/1-82.................RPFHNGVKC.........-...-----------------------....L----VPEVTFRAG
B3M4J7_DROAN/2-85.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLKCT
B3NHU0_DROER/2-85.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLKCT
B4QNW4_DROSI/2-85.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLKCT
Q54U48_DICDI/1-94.................VKSFGTEGRRQGT.....-QIP-----------------------PSTEI----FDYIVFKSS
E3LVA9_CAERE/2-84.................VIKDGL............-...-----------------------...PL----NRCITLSSS
D8MAI5_BLAHO/3-100.................VRIFGTEDRKCEV.....-FIG-----------------------VVVDI----KPVISFNRS
E3QL85_COLGM/1-101.................VRSFGTEGRRSRPE...E-EIA-----------------------PSDQV----YDYIIFRGS
D2VFF0_NAEGR/15-110.................VKMFGTEGRRQGD.....-QIP-----------------------PLDKI----YPFIIFKGS
A4S925_OSTLU/1-101.................VRSFGTEGRRTNG....V-QIP-----------------------PSVEV----YEYITFKGD
Q4UE88_THEAN/1-98.................VRSMGTEGRSTTT.....-EVP-----------------------PSTKV----HDFVVFRGE
F2PMZ7_TRIEC/1-104.................VVSHGTEGRRGNAS...D-EVP-----------------------PTSCV----YEYIVFRGS
C5FH61_ARTOC/1-104.................VISHGTEGRRGNAS...E-EVP-----------------------PASCV----YEYIVFRGS
F2SZB8_TRIRC/1-104.................VVSHGTEGRRGNTS...D-EVP-----------------------PTSCV----YEYIVFRGS
B2B0J3_PODAN/1-101.................VRTFGTEGRKGKIE...E-EVP-----------------------PSDQV----YEYIVFRGT
A9TBA5_PHYPA/7-110.................VRSFGTEGRKKDG....P-QIP-----------------------ASDKV----YDYIIFRGS
D8SR19_SELML/17-118.................VRSYGTEGRKKEG....P-QIP-----------------------PRDSV----YDYIIFRGS
E4ZQE4_LEPMJ/1-98.................VCSFGTEGRKGGK....D-EYP-----------------------PSDVI----YEQIVFRGS
E3RJ42_PYRTT/1-98.................VRSFGTEGRKGGK....D-EYP-----------------------PSDVV----YEQIVFRGS
B2W2Z3_PYRTR/1-98.................VRSFGTEGRKGGK....D-EYP-----------------------PSDVV----YEQIVFRGS
B9N0P5_POPTR/10-110.................VRSYGTEGRKKDG....P-QIA-----------------------PSDKV----YEYILFRGS
B9HIX6_POPTR/10-110.................VRSFGTEGRKKDG....P-QIL-----------------------PSDKV----YEYILFRGS
Q9AV95_SOYBN/10-110.................VRSFGTEGRKKDG....L-QIP-----------------------PGDKI----YEYILFRGT
B9HWN3_POPTR/17-117.................VRSFGTEGRKKDG....P-QIL-----------------------PSDKV----YEYILFRGS
C5Z2C6_SORBI/6-105.................VRSFGTEGRKKDG....Q-QIP-----------------------ASDKI----YEYILFRGS
B9S1S4_RICCO/7-107.................VRSYGTEGRKKDG....P-QIP-----------------------STDKV----YEFILFRGS
B9SEH0_RICCO/16-118.................VRSFGTEGRKKDG....P-QIP-----------------------PSDKV----YEYILFRGS
C0P9P8_MAIZE/9-108.................VRSFGTEGRKKDG....Q-QIP-----------------------ASDKI----YEYILFRGS
F2CV11_HORVD/7-106.................VRSFGSEGRKKDG....Q-QIP-----------------------ASDKI----YEYILFRGS
C5XEW0_SORBI/33-136.................VRSFGTEGRKKDG....M-QIP-----------------------ASDKV----YEYILFRGT
B9FTF3_ORYSJ/4-103.................VRSFGTEGRKKDG....Q-QIP-----------------------ASDKI----YEYILFRGS
D7KQT8_ARALL/11-112.................VRSFGTEGRKKDG....P-QVP-----------------------PSDKV----YEYILFRGT
Q657T0_ORYSJ/29-132.................VRSFGTEGRKKDG....V-QIP-----------------------ASTKV----YEYILFRGS
B9SIZ7_RICCO/18-118.................VRSFGTEGRKRDG....P-QVP-----------------------PSDKI----YEFILFRGS
B8B2T9_ORYSI/2-101.................VRSFGTEGRKKDV....Q-QIP-----------------------ASDKI----YEYILFRGS
B9N200_POPTR/18-118.................VRSFGTEGRKKDG....L-QVP-----------------------PSDKV----YEFILFRGT
B9H3R0_POPTR/25-125.................VRSFGTEGRKKDG....L-QVP-----------------------PSDKI----YEFILFRGT
B6K0S5_SCHJY/1-100.................VLWCGTEGRKGDPS...Q-EIP-----------------------ASDSV----FDYIVFRGS
A8X5I4_CAEBR/1-101.................VRSFGTEKRPTAN.....-PVA-----------------------ARDDV----YEYIIFKAS
B2ZCP0_CAEBE/2-102.................VRSYGTEKRPTSN.....-PVA-----------------------ARDDI----YEYIIFKAS
E2F3W7_SCHMD/1-98.................VKSFGTEDRYAET.....-PVP-----------------------PRDEI----YEYIIFRGS
E4UT72_ARTGP/1-104.................VVSHGTEGRRGNAS...D-EVP-----------------------PTSCV----YEYIVFRGS
E1G1X5_LOALO/1-102.................VRSFGTEDRPTPN.....-PVA-----------------------ARDDI----YEYIIFKAT
C1GYA0_PARBA/1-104.................VISHGTEGRRGNPA...E-EIA-----------------------PSASV----YEYIVFRGS
C0NK89_AJECG/1-104.................VVSHGTEGRRGNPA...E-EIA-----------------------PSASV----YEYIVFRGS
A6RQW3_BOTFB/1-101.................VKSHGTEGRKNNPD...E-EIA-----------------------ASDNI----YEYIVFRGG
C8VTV1_EMENI/1-104.................VVSYGTEGRRGNPD...E-ELP-----------------------PSSSV----YEYIVFRGS
Q0D0U7_ASPTN/1-103.................VASFGTEGRRGNPA...E-EIP-----------------------PSASV----YEYIVFRGS
B6QIP7_PENMQ/1-103.................VVSHGTEGRRGNST...E-EVP-----------------------ASTTI----YEYIVFRGS
A1D2I3_NEOFI/1-104.................VVSFGTEGRRGNPA...E-EIP-----------------------PSASV----YEYIVFRGS
B8MJZ3_TALSN/1-103.................VVSHGTEGRRGNQG...E-EIP-----------------------ASTTI----YEYIVFRGS
A1CPM4_ASPCL/1-104.................VVSFGTEGRRGNPN...E-EIP-----------------------PSASV----YEYIVFRGS
E9DIB2_COCPS/1-102.................VISHGTEGRRGNPS...E-EIA-----------------------PSASV----YEYIVFRGS
D5G7H6_TUBMM/1-99.................VVSHGTEGRRGDPA...K-EIA-----------------------GSDNV----YEYIVFRGG
Q2UNT4_ASPOR/1-104.................VVSFGTEGRRGKPE...D-ELP-----------------------PAPHI----YEYIVFRGS
E4X6L1_OIKDI/3-98.................VRSFGTENRDCER.....-HVA-----------------------AREET----FEYIIFRGT
Q5CK91_CRYHO/1-96.................VRYFENGPN...G....A-PGP-----------------------ASSTV----FEMIVFRGS
F1LC23_ASCSU/24-125.................VRCFGTEDRPTTN.....-RVA-----------------------ALDDI----FEYIIFKSS
E5SSZ2_TRISP/1-100.................VRSFGTEDRPAEQ.....-VVP-----------------------PRNEV----YEYIIFRAS
F1L7R2_ASCSU/24-125.................VRSFGTEDRPTSN.....-PVP-----------------------ARNNV----YDYIIFKAS
E3KKB4_PUCGT/1-103.................VRSMGTEGRKSNPS...E-EIA-----------------------ATDQL----YEFIVFRAA
B4IX73_DROGR/1-96.................VRSFGTEDRDTQF.....-QIA-----------------------PQSQI----YDYILFRGS
B4N336_DROWI/2-97.................VRSFGTEDRETQF.....-QIA-----------------------PQSQI----YDYILFRGS
B3NHB8_DROER/1-96.................VRSFGTEDRDTQF.....-HIA-----------------------PQSQI----YDYILFRGS
D6WGE3_TRICA/1-95.................VRSFGTEDRETPY.....-PVP-----------------------AQNQV----YDYILFRGS
Q7PTC4_ANOGA/1-90.................VKSYGTEDRETQF.....-PIA-----------------------PQNQC----YDYILFRGT
Q16NS4_AEDAE/1-94.................VKSYGTEDRETQF.....-PIA-----------------------PQNQC----YDYILFRGS
E3X8Q0_ANODA/1-93.................VKSYGTEDRETQF.....-PIA-----------------------PQNQC----YDYILFRGT
A8NDX3_COPC7/1-99.................VYSMGTESRRPPA....E-YIP-----------------------PAPDP----YAFIVFKAA
E9E117_METAQ/1-101.................VRSFGTEGRRGRPE...E-EIT-----------------------PSDQV----YEYIVFRGS
F0VJJ4_NEOCL/27-129.................VRSLGTEGRRHPE.....-DIP-----------------------PSPQV----YDCIVFKGS
F1L295_ASCSU/3-104.................VRCFGTEDRPTRN.....-PFA-----------------------GSDDI----YEYIIFNAA
A4I195_LEIIN/1-95.................VRIYGTEGRKGGGV...E-EVP-----------------------PTEQL----FEFIVFRGS
Q4QA41_LEIMA/1-95.................VRIYGTEGRKGGGV...E-EVP-----------------------PTEQL----FEFIVFRGS
A4HEG4_LEIBR/1-95.................VRIYGTEGRKGGGV...D-EVP-----------------------STEQL----FEFIVFRGS
E9AXD1_LEIMU/1-95.................VRIYGTEGRKGGGV...E-EVP-----------------------PTEQL----FEFIVFRGS
F0X7G9_GROCL/1-101.................VISYGTEGRRGKPE...D-EIP-----------------------PADQI----YEYIVFRGN
C9SLB1_VERA1/1-101.................VKSFGTEGRKSRPE...E-EIA-----------------------PSDQV----YEYIIFRGS
E0VL61_PEDHC/1-93.................VRSFGTEDRETQY.....-PVP-----------------------AQSQV----YDYILFRGS
F0J935_AMBVA/1-102.................VRSFGTEDRPTDR.....-PVA-----------------------PRDEV----YEYIIFRAH
E9GNF0_DAPPU/1-102.................VRMFGTENRPTDN.....-PVA-----------------------ARDEV----FEFIIFRGQ
E2A710_CAMFO/1-95.................VRSFGTEDRETQL.....-PVA-----------------------PQNQV----YEYILFRGS
Q4S5K0_TETNG/1-97.................VKCFGTEGRPTDR.....-PTP-----------------------PKDDI----YEYITFRGS
F1QIF2_DANRE/1-98.................VRSFGTEDRPTDR.....-PIA-----------------------PRDET----FEYIIFRGS
LS14B_XENTR/1-98.................VRSFGTEDRPTDR.....-PAP-----------------------PREEV----YEYIIFRGS
Q4TCT1_TETNG/3-100.................VNSYGTEDRHTDR.....-PVP-----------------------PKEEI----YEYIIFRGS
Q6P0B2_DANRE/1-98.................VKSFGTEDRPTDR.....-PIP-----------------------PRDDV----FEYIIFRGS
L14BB_XENLA/1-98.................VRSFGTEDRPTDR.....-PAP-----------------------PREEV----YEYIIFRGS
D2HE65_AILME/3-107.................VRSFGTEDRPTDR.....-PAP-----------------------PREEI----YEYIIFRGS
D3ZU15_RAT/3-100.................VRSFGTEDRPTDR.....-PAP-----------------------PREEI----YEYIIFRGS
Q4SDR1_TETNG/2-99.................VRSLGTEDRPTDR.....-PIP-----------------------PRDEV----FEYIIFRGS
A8E579_DANRE/1-98.................VRSFGTEGRPTDR.....-PVP-----------------------ARDEI----FEYIIFRGS
E6ZFT9_DICLA/3-100.................VKSYGTEDRHTDR.....-PVP-----------------------PKDEI----YEYIIFRGS
E9CGL0_CAPO3/1-100.................VRSLGTEGRGIDG....K-EVP-----------------------ARADV----FEYIVFRGS
C3XU47_BRAFL/1-99.................VRSYGTEDRPTDR.....-PVA-----------------------PRDEV----YEYIIFRGS
Q4XSD8_PLACH/3-96.................VRSYGTEGR.RQP.....-DIP-----------------------ASNEV----YDFIIFRGK
Q7RRL5_PLAYO/3-96.................VRSYGTEGR.RQP.....-DIP-----------------------ASNEV----YDFIIFRGK
B3LA44_PLAKH/3-96.................VRSFGTEGR.RQP.....-DIP-----------------------PSNEI----YDFIIFRGK
A5K436_PLAVS/3-96.................VRSFGTEGR.RQP.....-DIP-----------------------PSNEI----YDFIIFRGK
C5L0T8_PERM5/2-98.................VKSSGTEGR.KTP.....-HVP-----------------------PSDEV----YDFIIFRGK
C5KQI2_PERM5/2-98.................VKSFGTEGR.KVP.....-NVP-----------------------ASDEV----YDFIIFRGK
C5LVV7_PERM5/2-98.................VKSFGTEGR.KTP.....-DIP-----------------------ASDEV----YDFIIFRGS
B3S6N3_TRIAD/3-104.................VKSFGTENRDRNR.....-PIP-----------------------PQSQV----YPYVIFNGA
E6ZRW2_SPORE/1-98.................VRSWGTEGRVSAQGRPQE-EIP-----------------------ASDHV----YQHIMFRAA
Q4P2V7_USTMA/1-99.................VRSWGTEGRRSAQGKSQE-EIP-----------------------PSDHV----YDYIMFRAA
B4N6E7_DROWI/3-89.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLKCS
B0DQA2_LACBS/1-98.................VYSMGTESRRPPT....E-FIP-----------------------PVQEP----YQYIIFRAS
Q4E1M8_TRYCC/1-97.................VRVFGTEGRGQEAG..LA-QIP-----------------------PADQL----FDQIVFRGS
D0A5I6_TRYB9/1-97.................VRVFGTEGRAKEKG..QV-EVP-----------------------AAEQL----FDQIVFRGS
Q22BP4_TETTS/1-97.................VVSFGTEGRKPGN.....-EIL-----------------------PSATV----YDYISFKGQ
B4J3I1_DROGR/2-86.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLRCA
B4LF03_DROVI/2-86.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLRCA
B4KZK2_DROMO/2-86.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLRCA
B4HBW0_DROPE/2-88.................RAFRNGVPL.........-...-----------------------..RKQ----NAEVVLKCT
A3LQK8_PICST/1-98.................VRLFGTEGRMAAAGTPNL-EVM-----------------------PGSDV----YDYVVFRGS
C1FHK0_MICSR/1-99.................VKSYGTEGRKKVG....P-QIP-----------------------PSAEI----YDYIVFKGT
D7MU39_ARALL/27-127.................VRSCGTEGRKKDG....P-QIP-----------------------PCDRV----YDYILFRGS
F1M7Z1_RAT/1-82.................RPFHNGVKC.........-...-----------------------....L----VPEVTFRAG
A0ELI5_MOUSE/1-82.................RPFHNGVKC.........-...-----------------------....L----VPEVTFRAG
A5DQD8_PICGU/1-101.................VRSFGTEGRMAAAGNPSQ-EIM-----------------------PRPEI----YEYVVFRGS
E0VJ09_PEDHC/1-80.................A.FQNGYPY.........-...-----------------------....H----SRQVILSAK
B6AJV5_CRYMR/1-92.................VRHFGTEGR.CLP.....-EIP-----------------------PTPTI----FEMIVFRGS
Q5BZX0_SCHJA/2-99.................VWSFGTEDRPCER.....-PVA-----------------------PRNEE----YNQVVFRGR
Q6CVK7_KLULA/1-94.................VRCFGTEGRKGWGP...E-EIY-----------------------PNPNI----YDTVPFNGN
Q2LYI8_DROPS/4-85.................AFRNGVPLRKQ.......-...-----------------------.....----NAEVVLKCT
EDC3_HUMAN/1-81.................PFHNGV..KCL.......-...-----------------------.....----VPEVTFRAG
EDC3_XENLA/1-81.................PFHNGV..KCL.......-...-----------------------.....----VPEVTFRAG
Q4RS95_TETNG/1-80.................PFHNGI..KCP.......-...-----------------------.....----VPEVTFSAM
Q16Z12_AEDAE/1-80.................AVRNGIPLKKT.......-...-----------------------.....----TVEVTFTCK
EDC3_DANRE/1-83.................PFHNGV..KCT.......-...-----------------------.....----VPEVTFSAM

PF14438

Q5BDQ5_EMENI/104-178-----------------THRHLKQEQ..........QRA-----------------------NGVSD----VATTLEHSS
D8SR19_SELML/21-91-----------------VRSYGTEGRKKE.....GPQIP-----------------------PRDSV----YDYIIFRGS
Q93V36_ARATH/25-99-----------------AKLTKKGRSK.........SNV-----------------------ESGKI----VETLVILSS
A9TXE8_PHYPA/155-235-----------------ARHVKEGTHPTQG...ESGREA-----------------------ARKPP----IKKLQIQGK
Q4RG15_TETNG/9-83-----------------VHKRNEEESSS.......SAPP-----------------------RREDI----TDTMIFSPS
B4PRP5_DROYA/59-128-----------------PACIKSK............NLP-----------------------EEGKV----PKHIIFPAD
E9BAG4_LEIDB/11-89-----------------PRNLPSKVHS.........ALD-----------------------ASELS----DETRLFRYE
D3BPE8_POLPA/83-156-----------------ARKREVSP...........PSI-----------------------ITTAP----IPQLVIDAK
A8QGL3_BRUMA/12-97-----------------AHEVLTDDQKN........LLP-----------------------HKDQI----IEKLQIERD
D0MVB6_PHYIT/100-171-----------------TKRLSSG............QNA-----------------------TPFED----GSTVIFRRQ
D2A4A5_TRICA/121-194-----------------AAKVDNPNSPT........QTL-----------------------LADSF----VDKLIFKSG
E9CID8_CAPO3/95-174-----------------ARTVPTVPANGAQ....PTPPS-----------------------TRPTL----VTKLDIPAA
E2AAH8_CAMFO/34-101-----------------AHRVE..............EKI-----------------------SADNI----VEKLIFKSH
Q0USK0_PHANO/103-187-----------------VKKLLPAANAQTNGSGEISDDY-----------------------VGVGD----YHVMSFDMS
Q01A57_OSTTA/7-78-----------------KKYDAGSD...........VRA-----------------------QRGKP----VESMTVKVS
Q4D0Q9_TRYCC/10-88-----------------TRCLPSSKHKP........LDP-----------------------SCLEL----LEDTIIPYR
E9QQ61_MOUSE/236-307-----------------AHEKSTESS..........SGP-----------------------KREEI----MESVLFKCS
A7SAG3_NEMVE/46-125-----------------AHLVTKKIQHGSPE..EYIQVP-----------------------SKSAT----MDTFVIAAR
Q6FVS9_CANGA/40-117-----------------AKVIDNGMVKD........IDA-----------------------LAKSI----EDTLLIQGE
E9GS99_DAPPU/50-121-----------------VHTVDPSQP..........DKI-----------------------DVKSV----SREVVFGSQ
A9V850_MONBE/3-84-----------------ACVKPTSNAKAPFA..DPPTVL-----------------------KPSDD----IEVIVIQGK
B5YMG3_THAPS/153-230-----------------CRVVVTK............EET-----------------------SSIEN----GSTVLIPVE
D8TQ60_VOLCA/53-130-----------------AKVIKNPTTSS.......DRNA-----------------------LAEKP----VPILTIPAA
B0XQ85_ASPFC/25-109-----------------VQRPAKQDHQRTNGMSDVVSPF-----------------------LGTAP----DHSMSFDVK
A2CF31_DANRE/61-132-----------------AHRKSVEPN..........AGP-----------------------RREDI----VESIIFKSS
C1N5K5_MICPC/11-96-----------------AELKMHPKGADGS....APKRA-----------------------TRSIP----SPSTTFVVA
Q8ILA7_PLAF7/22-97-----------------TRMIPK.............NEN-----------------------TNGPI----NKSMIITDN
A8NUD4_COPC7/90-158-----------------VKEISNP...............-----------------------.GAPL----KDSLFIAST
ATX2_DICDI/83-159-----------------ARKKDTN............NRV-----------------------ITTLP----LPLVIIEAK
F0ZSI7_DICPU/73-152-----------------ARKKDLN............NKV-----------------------ITTQP----LPIIIIQAK
Q8RY61_ARATH/21-95-----------------ARITKKGTSI.........SNV-----------------------ASGSV----VDTLVILSS
D2V0R5_NAEGR/134-205-----------------AKLI...............GGS-----------------------GTQTI----HETMTFKSK
Q94AM9_ARATH/47-126-----------------ACLIKDGTLRGHK....SRSEF-----------------------VRKPP----SKTFIIPAD
B1Y929_THENV/10-78-----------------ASKAG..............EKF-----------------------VRVFI----MYRYIVHID
D7FVW6_ECTSI/93-178-----------------AKVQGATDQSN.......GGQS-----------------------KIDSR----GGTLMLSGD
Q6PFI6_DANRE/39-119-----------------VHKVKNEEGDGGGG.GGTAVYP-----------------------RKEEI----TDTMIFGPS
D8RJA7_SELML/76-157-----------------ARLTKEAGGKSGKG..DAVKQA-----------------------ARKPP----TKSLIIYAK
Q9P3K1_NEUCS/92-165-----------------QKKLPNSAE..........MNG-----------------------ASRKE----QGTMTFQKK
B9PGS2_TOXGO/32-107-----------------ARDLPS.............KTR-----------------------VSGEI----KRQMHLPDR
A8JCT6_CHLRE/51-129-----------------AKVIKDPSAPAV......DKTT-----------------------LAEKP----VAVLTIPAA
C9JXV8_HUMAN/121-192-----------------VHRKASEPA..........GGP-----------------------RREDI----VDTMVFKPS
Q8L793_ARATH/50-125-----------------ACLIRDSRGTK........SRT-----------------------VSKPS----SKLLKIPAD
Q6BJB7_DEBHA/52-137-----------------PQIFSKSLIDEK......SNAD-----------------------KSNEI----PEKLVIQAK
E4XJQ7_OIKDI/47-119-----------------VHKVKMLGD..........GPT-----------------------HKGEI----IDDMIFPVN
Q6CJX9_KLULA/42-121-----------------PKVLDKGFDES.......DINA-----------------------LSAEL----SETLTIEPK
Q4PB76_USTMA/116-192-----------------QQLLPAKDKD.........SQP-----------------------QLGEF----KASLIINYK
B3RJZ6_TRIAD/63-136-----------------VHRLKTSDNGN........QLR-----------------------IDDNI----TENMIFHPK
A3LNE7_PICST/2-83-----------------PVNVGKSLIAEK......SNID-----------------------SNGDH----LDKLIIQSK
C4YPF0_CANAW/21-94-----------------PQLVGSSLLN.........EKN-----------------------NLDKL----PENLIIQAK
Q75F67_ASHGO/41-119-----------------PRIIDKGIDEE.......DAAV-----------------------LSAQL----KETLLIEGD
B7FW14_PHATC/78-161-----------------TQTVKATTADSK......ANTV-----------------------TPIQP----NATVVLDMS
E7KCP4_YEASA/50-127-----------------PRVADSGVSDS........VDD-----------------------LAKTL----GETLLIHGE

PF01423

Q9GP42_ECHMU/11-76-----------------TEEYVEGQ.....................................LKNKY....GD.TFIRGN
Q8MRZ3_DROME/144-252-----------------VTETWKRRKYNYGEQNICDTPVDCTGRLKELGITLPRTVVKNLNRKNVEIRRELPQ.ILIRGE
LSM3_MOUSE/19-97-----------------VEETVTTIEIDEETYEEIYKS........................TKRNI....PM.LFVRGD
RSMB_SCHPO/4-80-----------------CQEYRHIKKQNVPSNSVYE..........................EKRML....GL.VILRGE
SMD3_MOUSE/8-73-----------------ITVTYRDG.....................................RVAQL....EQ.VYIRGS
Q9AVY1_GUITH/10-75-----------------TTEKKDSL.....................................IVRDL....GY.VLIKGD
RSMB_DROME/7-82-----------------CEEFRKIRSKNSKVPERE...........................EKRVL....GF.VLLRGE
RUXE_CAEEL/19-85-----------------AEEVNMKTK....................................GRNKI....GR.ILLKGD
Q9C2A8_NEUCS/10-75-----------------ITVTARDG.....................................RVSHL....EQ.VYIRGS
Q95XN6_CAEEL/9-74-----------------TEEYSNGQ.....................................LQNKY....GD.AFIRGN
Q9SI54_ARATH/9-82-----------------AVEFVRDHDDPLKTTD.............................QTRRL....GL.IVCRGT
SMD2_SCHPO/33-111-----------------VKEMWTEKKRTASGKKGKA.IN.......................KDRFI....SK.MFLRGD
HFQ_RALSO/6-65-----------------VTQ.......................................................MVYKH
LSM5_SCHPO/9-75-----------------VTEYD........................................TVTGVTEKHSE.MLLNGN
Q9GYZ5_9TRYP/11-76-----------------VKITAKGK.....................................NPEMA....ET.YMVCGS
RUXG_CAEEL/7-72-----------------AVEYQKDG.....................................GSVNL....GM.TVIRGN
SMD3_SCHPO/6-71-----------------ISVTARDG.....................................RVSHL....DQ.VYIRGS
RUXF_MOUSE/9-74-----------------TEEYIDGA.....................................LSGHL....GE.VLIRCN
RUXG_MOUSE/7-72-----------------CVEMATSG.....................................QQNNI....GM.VVIRGN
Q8PUF1_METMA/5-71-----------------TMEIVKGE.....................................KVRSL....GS.VVLRGN
Q98RT8_GUITH/8-71-----------------NQVKQ........................................ENCFI....NEIVLIRGD
Q8TZN2_PYRFU/4-70-----------------VVDVIGNR..............................................GKQMLIGLE
RUXE_MOUSE/23-89-----------------AEEIHSKTK....................................SRKQL....GR.IMLKGD
O18694_CAEEL/16-84-----------------VVEYENTADGK..................................RMTKL....DT.ILLNGN
Q98S70_GUITH/5-70-----------------ISDIDIDG.....................................QKFFK....GN.LSIRFN
RUXG_SCHPO/7-72-----------------SIEEKVDG.....................................EKVKI....GS.VAIRGN
LSM2_SCHPO/5-72-----------------ISVVDASKYP...................................HMAAV....KD.LFIRGS
LSM6_SCHPO/7-72-----------------TEEYVNGK.....................................KTNVY....GD.AFIRGN
HFQ_BACSU/4-64-----------------GKQQ......................................................LIYKH
O27489_METTH/12-66-----------------EE....................................................GL.QFIKGT
LSM4_YEAST/5-81-----------------VTEYSEESAINSEDNAESS..........................KAVKL....NE.IYIRGT
Q9U7L5_9TRYP/25-91-----------------ATETNSKTK....................................ESTHL....GK.ILLRSD
Q9VTW6_DROME/5-72-----------------ISVTDPDKYP...................................HMLSV....KN.CFIRGS
RUXF_SCHPO/10-75-----------------AEELVDGV.....................................KTGDL....GE.ILIRCN
LSM4_SCHPO/5-71-----------------VIRTMPDGD....................................KFFRL....PE.CYIRGN
HFQ_CLOPE/6-66-----------------GKQQ......................................................LVYKH
Q8RMG6_GLUDI/7-67-----------------GHTQ......................................................LVYKH
Q8VYI0_ARATH/5-74-----------------SHERVFSTKEGV.................................QQHVL....GL.YIIRGD
Q40942_BIGNA/8-70-----------------SSYSK........................................ESNYF....DI.LIVRGN
LSM5_YEAST/10-83-----------------AVEWLIDPEDES.................................RNEKVMQHHGR.MLLSGN
HFQ_CLOAB/7-67-----------------GKQM......................................................MIYKH
LSM3_YEAST/6-78-----------------AVETIYQLNNEELSE..............................SERRC....EM.VFIRGD
RUXE_SCHPO/18-83-----------------AVQVDAKN.....................................NKREL....GR.ILLKGD
LSM7_SCHPO/26-98-----------------VEEQLRNPEDGKLTG..............................AIRKL....GL.VVVRGT
LSMH_ENCCU/6-66-----------------SSVEG........................................SEDKV.......LFLRGE
LSM1_YEAST/44-114-----------------CVERIYFSEENKY................................AEEDR....GI.FMIRGE
Q9U1W8_CAEEL/19-97-----------------VEETITTREVDEDTFEEIYKQ........................TKRVV....PM.LFVRGD
RUXX_ARCFU/7-72-----------------AEEIQNGE.....................................VVRKV....GS.VVIRGD
SMD3_CAEEL/9-74-----------------TVVTFRDG.....................................RSHQL....DN.VFIRGN
SMD3_YEAST/9-74-----------------VIATEPQG.....................................AVTHM....DQ.IFVRGS
Q9VJI7_DROME/22-96-----------------TVEYLRDSDEPYKLTEE............................QTRSL....GL.VVCRGT
Q96UB4_NEUCS/9-74-----------------VTEFDYSG.....................................NHTKL....KK.ILLNGN
LSM7_YEAST/28-104-----------------TVEYMSNPDDENNTELISK..........................NARKL....GL.TVIRGT
HFQ_AQUAE/3-63-----------------KQQT......................................................LVYKH
LSM2_ENCCU/5-70-----------------VRILSSHP.....................................GLSSI....SV.CSIRGS
Q9SSF1_ARATH/5-70-----------------VKMSLKGK.....................................NPVTL....DH.LSLRGN
Q20229_CAEEL/12-80-----------------VVERTFVEKYF..................................CETGQ....GF.MLIRGE
RUXG_DROME/7-72-----------------TVEECKDN.....................................TKNNI....GM.VVIRGN
RUXE_YEAST/19-92-----------------AVEIPVNSADGKEDVE.............................KGTPL....GK.ILLKGD
Q8KNP9_BACTI/22-77-----------------GKQQ......................................................LVYKH
LSM6_YEAST/14-83-----------------ATEHYESN.....................................NNKLLNKFNSD.VFLRGT
RUXX_METAC/7-72-----------------AEELRDGE.....................................VVSKF....SS.VVIRGD
Q8ZYG5_PYRAE/14-78-----------------AEEIIDG......................................NVYKR....GT.MVVRGE
LSM1_MOUSE/8-76-----------------TVERIHVGKKY..................................GDIPR....GI.FVVRGE
Q9HPS2_HALSA/16-69-----------------E.....................................................DT.TIIRGD
RUXF_YEAST/17-83-----------------AEEFVAGV.....................................SHGTL....GE.IFIRCN
RSMB_CAEEL/7-82-----------------CEEHRQIKPKAGKKTDGE...........................EKRIL....GL.VLVRGE
Q979R0_THEVO/6-70-----------------VDENSEN......................................VSRKL....GT.VVIRGS
RUXF_NEUCR/10-76-----------------TKEYINRK.....................................FTGAL....GQ.VLIRCN
Q5JI86_PYRKO/5-71-----------------VTDYAGNK..............................................ARELIVKID
Q8SRW7_ENCCU/7-67-----------------VTEPSGVE..............................................DT.AVVRGE
Q9AW42_GUITH/8-72-----------------AFVIKKK......................................KVQKL....TL.VFLRGS
O96265_PLAF7/22-98-----------------VREIWVEVVKDKKKKKKIN..........................KDRYI....SI.LFLRGD
LSM3_SCHPO/12-90-----------------AEEIVTIFDDEETDKDKALKT........................IRKHY....EM.LFVRGD
RSMB_YEAST/10-97-----------------CIEERVPKTQLDKLRPRKDSKDGTTLNIKV...............EKRVL....GL.TILRGE
RUXX_AERPE/11-75-----------------AEEIGET......................................SIRRL....GL.TLVRGD
Q23543_CAEEL/14-87-----------------CREYLRDPQNPSVVGD.............................ETRQL....GL.IVARGT
RUXX_METTH/16-81-----------------AEELEDGE.....................................VTRRL....GT.VLIRGD
Q96UG3_KLULC/5-69-----------------VTHVASG......................................ETLKL....PS.FYLKGS
Q98S49_GUITH/5-70-----------------CSEVITEQ.....................................NLGFL....GL.VLIRCN
LSM8_SCHPO/1-70-----------------SFERIISMDQDM.................................ETIPL....GV.YLLRGE
RUXX_THEAC/12-77-----------------ASEIINGE.....................................NKGVY....DR.VLVRGD
Q9FKB0_ARATH/12-80-----------------VTEYEITAEGR..................................RVTKL....DQ.ILLNGN
RUXF_CAEEL/11-76-----------------AEEYIDGN.....................................SQGNL....GE.ILIRCN
SMD1_YEAST/5-97-----------------VKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASD..........NIASL....QY.INIRGN
Q97ZQ0_SULSO/10-75-----------------SEEIQSDG.....................................SGKKL....GT.IVIRGD
LSM2_YEAST/5-72-----------------ISCTDEKKYP...................................HLGSV....RN.IFIRGS
RUXX_PYRAB/7-72-----------------AEMIQDGE.....................................VVKRY....GK.IVIRGD
Q8LFL8_ARATH/13-81-----------------ACERVIVGEQY..................................CDIPL....GL.YVIRGE
Q9CAX7_ARATH/8-72-----------------TVEVNGD......................................DKTDI....GM.VVIRGN
Q8SW39_ENCCU/8-72-----------------VVVTSNN......................................SSLSR....KE.VLIRGS
SMD1_CAEEL/5-70-----------------VSMTVKNK.....................................EPVKL....DT.LSIRGN
RUXG_YEAST/5-73-----------------AMEINGEDPA...................................NNHQL....GLQTVIRGN
LSM8_YEAST/3-66-----------------VFNRI........................................SKEFI....CKAQLLRGS
SMD2_YEAST/34-106-----------------VKELWTEKKGKNVIN..............................RERFI....SK.LFLRGD
RUXE_DROME/22-88-----------------AEEVYVKTR....................................QRRNL....GR.IMLKGD
HFQ_THETN/8-69-----------------SKQQ.....................................................LLIYKH
SMD2_CAEEL/32-111-----------------VKEMWTEVPKTGKGKKKAKSVA.......................KDRFI....SK.MFLRGD
Q8SSM1_ENCCU/5-65-----------------VVV..........................................DGAPA....ST.YTVRGS
NAA38_HUMAN/3-72-----------------SHERVFSSSQGV.................................EQVVL....GL.YIVRGD
Q9X393_BACAN/1-61-----------------GKQQ......................................................FIYKH
Q9GYZ4_9TRYP/37-105-----------------AVELTMVNNEQ..................................KERSI....RN.MFLRGA
LSMD1_HUMAN/43-114-----------------AQEFLKPSDSFSAG...............................EPRVL....GL.AMVPGH
Q92C58_LISMO/6-66-----------------GKQQ......................................................LVFKH
HFQ_BRUSU/6-66-----------------GHSQ......................................................LVYKH
LSM5_HUMAN/16-84-----------------VTEFEITPEGR..................................RITKL....DQ.ILLNGN
LSM10_MOUSE/19-84-----------------VTYTDRWG.....................................HQVEL....DD.LFVTGR
LSM1_SCHPO/14-82-----------------TIERIYVDDMY..................................GDIDR....GV.YIVRGE
Q95XD4_CAEEL/3-72-----------------AHERSYSETEGV.................................LTTPL....GL.YIIRGE
LSM4_CAEEL/6-72-----------------VIFTSKDGD....................................KFFKM....SE.AYVRGS
Q8SRU9_ENCCU/10-78-----------------VIERIFHDTRY..................................AERRH....EL.FIIRGE
Q8SS46_ENCCU/16-80-----------------CTEREGE......................................ASVKI....GE.VSIRCN
Q9W087_DROME/2-71-----------------CHERVFSTTSGI.................................EQIVL....GL.HIIRGD
LSM7_HUMAN/13-86-----------------TIEYMRDPDDQYKLTE.............................DTRQL....GL.VVCRGT
Q9M0C7_ARATH/19-85-----------------AEEVSIKKK....................................TRKPL....GR.ILLKGD
NAA38_YEAST/4-68-----------------VEERMGS......................................SSRMM....GL.VSVPRR
Q9GYZ7_9TRYP/8-71-----------------AVEKAK.......................................QETEL....GD.MLLRNN
Q9LMN4_ARATH/14-92-----------------VEEVITTIEIDDETYEEIVRT........................TKRTV....PF.LFVRGD
Q8TYS2_METKA/5-69-----------------CVEIDED......................................SEVRL....GR.VLIRGD
Q9GYZ3_9TRYP/17-83-----------------ATEVHLKTG....................................EVVQL....GK.ILLRSD
O29885_ARCFU/6-72-----------------AMECKGEE.....................................KVRSL....GE.IVLRGN
Q9I9E5_DANRE/7-82-----------------CDEFRKIKPKNSKQPERE...........................EKRVL....GL.VLLRGE
Q99UG9_STAAM/5-65-----------------GKQH......................................................LIYKH
HFQ_THEMA/7-67-----------------NQQS......................................................LIYKH
SMD1_SCHPO/5-70-----------------VKMTVKGR.....................................EPVPV....ET.LSIRGN
Q8SSB9_ENCCU/5-70-----------------VTIQKEDG.....................................SSIFI....NE.CYLKGT
Q8ZYP8_PYRAE/14-80-----------------AAELDKSGE....................................PKTRY....GR.IVIRGS
Q9W2K2_DROME/11-79-----------------TIERIHVGNEY..................................GDIPR....GV.FIIRGE
Q9LM92_ARATH/10-75-----------------ITYTAKDG.....................................KVSQL....EH.VFIRGS

PF12701

E1BEA2_BOVIN/1-82DITELK-ILEIPG........PGETQHFGDLHQT
B9PHG6_TOXGO/24-126DIKDLT-VCSEPDPSLVSHLSAFPPDPAIVSMSG
Q7QBK6_ANOGA/1-83DIAKLD-LISCSN.......VPSIPSKPVATVAA
E7M179_YEASV/1-93EVKDLS-ILDAN.........INDIQPVVPQMMP
SUM2_SCHPO/1-101DVKDLR-IEEPATTPS.APPVQPPNDPAIIGSNS
Q21740_CAEEL/1-82DISRLK-VIRGATQ......STQKSQPLPVQNSS
Q8L7G2_ARATH/21-116NIKEII-VQPPTW........GLARGSTCSKSCL
Q9FH77_ARATH/27-127DIKDLQ-VNPSPSAQ...SRQEIQSEQDVNQSPH
Q9ASU0_ARATH/11-112DIKDLQ-VKASPPVQP..PASTINNDPAIIQSHY
B0XR11_ASPFC/1-104DVKDIS-VAEEKKENAQPEPPRVPDDPAILGVSS
FBK83_ARATH/13-130DIKSVE-VLSLP........PPARHNSAIGHVGS
Q9XW17_CAEEL/1-101DIKDLI-VCDTPKMAN..IGGGLPYDPAIISVSS
Q9VTZ0_DROME/1-96DIKDIR-VVNNHTL.......PHHNDPAIMQAQL
Q5TBQ1_HUMAN/3-100DIKDIT-VCEPPKA.....QHTLPQDPAIVQSSL
D3Z845_RAT/1-98DIKDLT-VCEPPKP.....QCSLPQDPAIVQSSL
Q873J2_NEUCS/1-101DVKDLR-IEEGPAPPK.ENKPPMPDDPAILGSLT
Q8IK89_PLAF7/3-96DIKDVT-VSETGK........NIPDDPAIVSMNI
LSM14_PLEWA/1-98DIKDLT-VCEPPKP.....QCSLPQDPAIVQSSL
EDC3_PONAB/1-82DITELK-ILEIPG........PGDNQHFGDLHQT
C6TP77_DROME/2-85DIRSID-LIEPAK........QDLDGHTAPPPVV
A8XFX5_CAEBR/1-80DISSLK-VIRGAT........QTASPVKPSPSSN
E1ZRD6_CHLVA/11-105EIKELT-VVQPPPQ........QPPPAAAPPPFQ
D8LRU5_ECTSI/4-98DIMDLH-VHDAEA........DEGSQAAPPPPPT
D7FK17_ECTSI/1-95DIKDLH-VHETAEA.......PAPPPAAPVQPPP
EDC3_MACFA/1-82DITELK-ILEIPG........PGGNQHFGDVHQT
F1SIE7_PIG/1-82DITELK-ILEIPG........PGENQHFGDLHQA
D2HKY7_AILME/1-82DITELK-ILEIPG........PGENQHFGDLHQT
B3M4J7_DROAN/2-85DIRSID-LIEPVKQ........DVDVHTAPPVIN
B3NHU0_DROER/2-85DIRSID-LIEPVK........QDLDGHTAPPPVI
B4QNW4_DROSI/2-85DIRSID-LIEPVK........QDLDGHTVPPPVV
Q54U48_DICDI/1-94DINDLN-ICDYPTT.......PTDDSKLTTPKPT
E3LVA9_CAERE/2-84DISRLK-VIRAATQ.......PTSVTPAQVPLYS
D8MAI5_BLAHO/3-100GIQTIS-LIPQYSFF...DPSIADQTPAAMSSEM
E3QL85_COLGM/1-101DVKDLR-IEDHPGIKE.NKPPAMPEDPAIVNARP
D2VFF0_NAEGR/15-110DIKDLT-VCEPPQQ.......TPPVQPPRPQQGG
A4S925_OSTLU/1-101DIQDLE-IVENGASAA.AQQQQHAQQPQYMQQPQ
Q4UE88_THEAN/1-98DVTDIL-VNETQISN....DDNKFDDPAIFKTYK
F2PMZ7_TRIEC/1-104DVKDIN-FADNEKENQPPEQPQVPNDPAILGTTA
C5FH61_ARTOC/1-104DVKDIN-FADNEKENQAPEQPQVPNDPAILGTTA
F2SZB8_TRIRC/1-104DVKDIN-FADNEKENQPPEQPQVPNDPAILGTTA
B2B0J3_PODAN/1-101DVKDLR-IEEGPAAKE.NKPPAVPNDPAIVGARP
A9TBA5_PHYPA/7-110DIKDLQ-VKSSPPPPLQPPPLPQQTDPAIISLQG
D8SR19_SELML/17-118DIKDLQ-VKSSPQAHA..VHSQPYNDPAIIAQSQ
E4ZQE4_LEPMJ/1-98DVKDLR-IEEPAKEK...APPAMPQDPAIIGPSV
E3RJ42_PYRTT/1-98DVKDLR-IEEPVKEQ...AQPAMPQDPAIIGVQQ
B2W2Z3_PYRTR/1-98DVKDLR-IEEPVKEK...AQPAMPQDPAIIGVQQ
B9N0P5_POPTR/10-110DIKDLQ-VQSPPPDQ...TEEQIYNDPAIIQNHS
B9HIX6_POPTR/10-110DIKDLQ-VKSSPPVQ...SFPPINNDPAIIQSHY
Q9AV95_SOYBN/10-110DIKDLQ-VKSSPPVQ...PTPQVNNDPAIIQSHY
B9HWN3_POPTR/17-117DIKDLQ-VKSSPPVQ...SAPHINNDPAIIQSHY
C5Z2C6_SORBI/6-105DIKDLQ-VKSSPPSQ....SATLHNDPAIIQSHY
B9S1S4_RICCO/7-107DIKDLQ-VKTAPPAQ...KEEPVHDDPAIIQSHY
B9SEH0_RICCO/16-118DIKDLQ-VKSSPPAQP.TPTPPINNDPAIIQSHY
C0P9P8_MAIZE/9-108DIKDLQ-VKSSPPSQ....SATLHNDPAIIQSHY
F2CV11_HORVD/7-106DIKDLQ-VKSSPPAQ....PASLHNDPAIIQSHY
C5XEW0_SORBI/33-136DIKDLQ-VKSSPPPPPPPQAASLHNDPAIIQSHY
B9FTF3_ORYSJ/4-103DIKDLQ-VKSSPPAQ....PTTLHNDPAIIQSHY
D7KQT8_ARALL/11-112DIKDLQ-VKASPPVQP..PPPTINNDPAIIQSHY
Q657T0_ORYSJ/29-132DIKDLQ-VKSSPPPPPPPQPAAPHNDPAIIQSHY
B9SIZ7_RICCO/18-118DIKDLQ-VKSSPPVQ...TTKPIHTDPAIIQSHY
B8B2T9_ORYSI/2-101DIKDLQ-VKSSPPAQ....PTTLHNDPAIIQSHY
B9N200_POPTR/18-118DIKDLQ-VKSYPPVQ...TATPVHNDPAIIQSQY
B9H3R0_POPTR/25-125DIKDLQ-VKSSPPVQ...TATPVHNDPAIIQSQY
B6K0S5_SCHJY/1-100DVKDLR-IEEPAAPPQ..PQMQPPNDPAIISSNG
A8X5I4_CAEBR/1-101DIKDLI-VCDTPKMAN..IGSGLPYDPAIISVSS
B2ZCP0_CAEBE/2-102DIKDLI-VCDTPKMAS..VGAGITSDPAIISVSS
E2F3W7_SCHMD/1-98DIQDLH-VCEAPKKH....PQIMAQDPAILEITG
E4UT72_ARTGP/1-104DVKDIN-FADNEKENQAPEPPQVPNDPAILGTTA
E1G1X5_LOALO/1-102DIKDLI-VCETPKPVP.QLASGLAYDPAILSISS
C1GYA0_PARBA/1-104DVKDIS-VAEEQKENQQSEPPQVPNDPAILGSGM
C0NK89_AJECG/1-104DVKDIS-VAEEQKENQHPEPPQVPNDPAILGSGT
A6RQW3_BOTFB/1-101DVKDLR-IEEAPAPRE.SNPPQVPNDPAILGSGT
C8VTV1_EMENI/1-104DVKDIS-VAEDKKENAQPEPPQMPDDPAILGSVP
Q0D0U7_ASPTN/1-103DVKDIS-VAEEKDTAP.PEPPQVPDDPAILGSMS
B6QIP7_PENMQ/1-103DVKDIS-VAEEKKEPE.VPPSQVPDDPAILGSMS
A1D2I3_NEOFI/1-104DVKDIS-VAEEKKENAQPEPPQVPDDPAILGSMS
B8MJZ3_TALSN/1-103DVKDIS-VAEEKKEPE.IPPSQVPDDPAILGSMS
A1CPM4_ASPCL/1-104DVKDIS-VAEEQKETAQPEPPQVPDDPAILGSMS
E9DIB2_COCPS/1-102DVKDIS-FADEQKENQQAEPPQMPNDPAILGSSS
D5G7H6_TUBMM/1-99DVKDLR-IEETAPQP...PQPQVPDDPAILGSST
Q2UNT4_ASPOR/1-104DVKDIS-VAEDKKEDAPQEPQQVPDDPAILGVSR
E4X6L1_OIKDI/3-98DIYDLT-VCDLPQD.......RLPQDPAILNVSQ
Q5CK91_CRYHO/1-96DITDLA-VCQPAAAT...NNNGLPNDPAILSVNG
F1LC23_ASCSU/24-125DIKDLY-VCEAPKPMS.QFNDGLPNDPAILSASQ
E5SSZ2_TRISP/1-100DIKDLM-VRETPQPAP.VVCAGLHYDPAILSVSK
F1L7R2_ASCSU/24-125DIKDLI-VCDTPKPIA.QLSSGLPYDPAILTVSS
E3KKB4_PUCGT/1-103DVKDLS-IEAPAEAKPEPPKPSVPDDPAIMSTTA
B4IX73_DROGR/1-96DIKDIR-VVNNHNL.......PHHNDPAIMQAQL
B4N336_DROWI/2-97DIKDIR-VVNNHTL.......PHHNDPAIMQAQL
B3NHB8_DROER/1-96DIKDIR-VVNNHTL.......PHHNDPAIMQAQL
D6WGE3_TRICA/1-95DIKDIR-VVNNVA........QPLNDPAIMQLSV
Q7PTC4_ANOGA/1-90DIKDIR-VINNN.........PVPNDPAIMQMHL
Q16NS4_AEDAE/1-94DIKDIR-VINNN.........PVPNDPAIMQMHL
E3X8Q0_ANODA/1-93DIKDIR-VINNSV..........PNDPAIMQMQL
A8NDX3_COPC7/1-99EVKDLS-VDEQQMPP...PPRRPLDDPAIMSSAP
E9E117_METAQ/1-101DVKDLR-IEEHPGIKE.TKPPAMPDDPAIVGVST
F0VJJ4_NEOCL/27-129DIKDLT-VCSEPDPSLVNHLSAFPPDPAIVSMSG
F1L295_ASCSU/3-104DIDEVV-VYEVTRPIV.KFANGLPHDPAIVEISH
A4I195_LEIIN/1-95DIKDLT-VFRDSSS.......PQARDPAIVEVHA
Q4QA41_LEIMA/1-95DIKDLT-VFRDSSS.......PQARDPAIVEVHA
A4HEG4_LEIBR/1-95DIKDLT-VFRDGGS.......PQARDPAIVEVHA
E9AXD1_LEIMU/1-95DIKDLT-VFRDNSS.......PQARDPAIVEVHA
F0X7G9_GROCL/1-101DVKDLR-IEEGPSSKE.TNPNNVPNDPAIVGARS
C9SLB1_VERA1/1-101DVKDLR-IEDHPGIKE.NKAPAVPEDPAIVGSRP
E0VL61_PEDHC/1-93DIKDIR-VVTTQ..........IPNDPAIVQLVP
F0J935_AMBVA/1-102DIKDLR-VSEPPKPQS.TLPGGLTNDPAIVQHSA
E9GNF0_DAPPU/1-102DIKDIR-LCEPPAPQP.PIPGTLPYDPAIVQHSV
E2A710_CAMFO/1-95DIKDIR-VVNNVS........SIPNDPAIVQMTV
Q4S5K0_TETNG/1-97DIKDIA-LSEPPRS.....HRGLLPDPAIVQSFS
F1QIF2_DANRE/1-98DIKDLT-VCEPPKP.....TCSLPQDPAIVQSSL
LS14B_XENTR/1-98DIKDIT-VCEPPKA.....SHALPQDPAIVQSSL
Q4TCT1_TETNG/3-100DIKDIT-VSEPPKP.....QPGLPCDPAIVQSSL
Q6P0B2_DANRE/1-98DIKDLT-VCEPPKP.....TCNLPQDPAIVQSSL
L14BB_XENLA/1-98DIKDIT-VCEPPKA.....SHALSQDPAIVQSSL
D2HE65_AILME/3-107DIKDIT-VCEPPKA.....QHTLPQDPAIVQSSL
D3ZU15_RAT/3-100DIKDIT-VCEPPKA.....QHALPQDPAIVQSSL
Q4SDR1_TETNG/2-99DIKDLT-VCEAPKT.....SNNLPQDPAIVQSSV
A8E579_DANRE/1-98DIKDIT-VCEPLKV.....HHGLPQDPAIVQSSV
E6ZFT9_DICLA/3-100DIKDIT-VSEPPKP.....HHGLPRDPAIVQSSV
E9CGL0_CAPO3/1-100DIKDLH-VQSEPPAFV..PQAQQPQDPAIVQVTV
C3XU47_BRAFL/1-99DISDLH-VSEPPKTT....QSNQPQDPAIVQVMR
Q4XSD8_PLACH/3-96DIKDVT-VSEAPK........TIPDDPAIVSMNI
Q7RRL5_PLAYO/3-96DIKDVT-VSEAAK........TIPDDPAIVSMNI
B3LA44_PLAKH/3-96DIKDVT-VSEPAK........TIPDDPAIVSMNI
A5K436_PLAVS/3-96DIKDVT-VSEAAK........TIPDDPAIVSMNI
C5L0T8_PERM5/2-98DIKDLT-VLEGAGQ.....KTGPLTDPAIVSMNQ
C5KQI2_PERM5/2-98DIKDLT-VLEGAGQ.....KAGALVDPAIVSMNQ
C5LVV7_PERM5/2-98DIKDLT-VLEGASQ.....RSGVLSDPAIVSMQK
B3S6N3_TRIAD/3-104EIEDLQ-VCEPPRSTA.AEVTAPYSDPAIVSSSK
E6ZRW2_SPORE/1-98DVKDLK-IDDPN.........PPKQQPAPPQPAL
Q4P2V7_USTMA/1-99DVKDLK-IDDPNP........PKQQRPAPQPVLN
B4N6E7_DROWI/3-89DIQAIN-LIEPVKQ.....DVESHATPAVINKPT
B0DQA2_LACBS/1-98EVKDLA-VDEPAQQQ....RRNVHDDPAVIGASA
Q4E1M8_TRYCC/1-97DIKELT-VFEEPH........NAMMDPAVVTALP
D0A5I6_TRYB9/1-97DIEELT-VFEESH........NAMMDPAVVTALP
Q22BP4_TETTS/1-97DIEKIE-TNSNNAL.....GATNAPPPNIVSTSP
B4J3I1_DROGR/2-86DIKAIN-LIEPVKD.......AETTAPTVINKPT
B4LF03_DROVI/2-86DIKSIN-LIEPVKD.......AETTTPTVINKPT
B4KZK2_DROMO/2-86DIKSIN-LIEPVKD.......VETTTPTVINKPT
B4HBW0_DROPE/2-88DIRSIN-LIEPVNQ.....DVETHSTPTVMNKPT
A3LQK8_PICST/1-98DVKDLS-VLDTPID.......QVKPEPYIPAPQS
C1FHK0_MICSR/1-99DIQDIQ-IEQSGAP.....QQRPPQQQAPAPAPA
D7MU39_ARALL/27-127DIKDLQ-VNPSPSAQ...SKQEIQSEQDINQSSH
F1M7Z1_RAT/1-82DITELK-ILEIPG........PGDNQQFGDLHQT
A0ELI5_MOUSE/1-82DITELK-ILEIPG........PGDNQQVGDLHQT
A5DQD8_PICGU/1-101DVKDLS-VLDVPIDQ....VRPEPQQQYFAPSST
E0VJ09_PEDHC/1-80DINDLE-IIEASN.........DPSFSASVSIKK
B6AJV5_CRYMR/1-92DITDLA-VCQTNT........NFPQDSAIISVSV
Q5BZX0_SCHJA/2-99DLDDVH-VIQSSV........FLNEDSAIVSAAP
Q6CVK7_KLULA/1-94DVKDLN-ILDVPL........EQVQPVLPPQVSG
Q2LYI8_DROPS/4-85DIRSIN-LIEPVN........QDVETHSTPTVMN
EDC3_HUMAN/1-81DITELK-ILEIPG.........PGDNQHFGDLHQ
EDC3_XENLA/1-81DISELK-ILEIPS.........ESLKYTSDQLND
Q4RS95_TETNG/1-80DIKELK-ILDIRN..........GNARNSTSASA
Q16Z12_AEDAE/1-80DIERLE-LIASSN..........QQPQVSNQLDQ
EDC3_DANRE/1-83DIKDLK-ILEISKNS....I...EVSKQNGPESS

PF14438

Q5BDQ5_EMENI/104-178HRLG------------------------------
D8SR19_SELML/21-91DIKD------------------------------
Q93V36_ARATH/25-99NIVQ------------------------------
A9TXE8_PHYPA/155-235DIVQ------------------------------
Q4RG15_TETNG/9-83DLVT------------------------------
B4PRP5_DROYA/59-128TVVT------------------------------
E9BAG4_LEIDB/11-89DIIM------------------------------
D3BPE8_POLPA/83-156DFLG------------------------------
A8QGL3_BRUMA/12-97CIYS------------------------------
D0MVB6_PHYIT/100-171QLAH------------------------------
D2A4A5_TRICA/121-194DIST------------------------------
E9CID8_CAPO3/95-174DFVE------------------------------
E2AAH8_CAMFO/34-101DVVT------------------------------
Q0USK0_PHANO/103-187DVAD------------------------------
Q01A57_OSTTA/7-78EISS------------------------------
Q4D0Q9_TRYCC/10-88DVVM------------------------------
E9QQ61_MOUSE/236-307DFVV------------------------------
A7SAG3_NEMVE/46-125NIIS------------------------------
Q6FVS9_CANGA/40-117DVAE------------------------------
E9GS99_DAPPU/50-121MIVM------------------------------
A9V850_MONBE/3-84DIAQ------------------------------
B5YMG3_THAPS/153-230KVSH------------------------------
D8TQ60_VOLCA/53-130DLVQ------------------------------
B0XQ85_ASPFC/25-109DVVD------------------------------
A2CF31_DANRE/61-132DVVV------------------------------
C1N5K5_MICPC/11-96DVVS------------------------------
Q8ILA7_PLAF7/22-97LYTT------------------------------
A8NUD4_COPC7/90-158NIDS------------------------------
ATX2_DICDI/83-159DFLQ------------------------------
F0ZSI7_DICPU/73-152DFLQ------------------------------
Q8RY61_ARATH/21-95TIVQ------------------------------
D2V0R5_NAEGR/134-205DVQQ------------------------------
Q94AM9_ARATH/47-126ELVQ------------------------------
B1Y929_THENV/10-78SVEK------------------------------
D7FVW6_ECTSI/93-178DIVS------------------------------
Q6PFI6_DANRE/39-119DLVT------------------------------
D8RJA7_SELML/76-157DLVQ------------------------------
Q9P3K1_NEUCS/92-165EIVD------------------------------
B9PGS2_TOXGO/32-107CFVS------------------------------
A8JCT6_CHLRE/51-129DLVQ------------------------------
C9JXV8_HUMAN/121-192DVML------------------------------
Q8L793_ARATH/50-125ELVQ------------------------------
Q6BJB7_DEBHA/52-137DLMD------------------------------
E4XJQ7_OIKDI/47-119EVVS------------------------------
Q6CJX9_KLULA/42-121DVAG------------------------------
Q4PB76_USTMA/116-192DLET------------------------------
B3RJZ6_TRIAD/63-136DIVH------------------------------
A3LNE7_PICST/2-83DLID------------------------------
C4YPF0_CANAW/21-94DLID------------------------------
Q75F67_ASHGO/41-119DVAE------------------------------
B7FW14_PHATC/78-161KVVS------------------------------
E7KCP4_YEASA/50-127DVAE------------------------------

PF01423

Q9GP42_ECHMU/11-76NVFYIS.T--------------------------
Q8MRZ3_DROME/144-252NVVLVS.L--------------------------
LSM3_MOUSE/19-97GVVLVA.P--------------------------
RSMB_SCHPO/4-80FIVSLS.V--------------------------
SMD3_MOUSE/8-73KIRFLI.L--------------------------
Q9AVY1_GUITH/10-75SILTIS.S--------------------------
RSMB_DROME/7-82NIVSLT.V--------------------------
RUXE_CAEEL/19-85NITLIH.A--------------------------
Q9C2A8_NEUCS/10-75HVRFFI.V--------------------------
Q95XN6_CAEEL/9-74NVLYIS.T--------------------------
Q9SI54_ARATH/9-82AVMLVS.P--------------------------
SMD2_SCHPO/33-111GVVLVV.R--------------------------
HFQ_RALSO/6-65AISTVV.P--------------------------
LSM5_SCHPO/9-75GMCMLI.P--------------------------
Q9GYZ5_9TRYP/11-76KIRYVI.L--------------------------
RUXG_CAEEL/7-72SVVIME.P--------------------------
SMD3_SCHPO/6-71HIRFLI.V--------------------------
RUXF_MOUSE/9-74NVLYIR.G--------------------------
RUXG_MOUSE/7-72SIIMLE.A--------------------------
Q8PUF1_METMA/5-71NIILIT.P--------------------------
Q98RT8_GUITH/8-71SLVSIE.I--------------------------
Q8TZN2_PYRFU/4-70DINWIMLL--------------------------
RUXE_MOUSE/23-89NITLLQ.S--------------------------
O18694_CAEEL/16-84HITMLV.P--------------------------
Q98S70_GUITH/5-70NIRIMV.L--------------------------
RUXG_SCHPO/7-72SVIMIE.T--------------------------
LSM2_SCHPO/5-72VVRYVH.M--------------------------
LSM6_SCHPO/7-72NVLYVS.A--------------------------
HFQ_BACSU/4-64AISTFA.P--------------------------
O27489_METTH/12-66KIAFIA.M--------------------------
LSM4_YEAST/5-81FIKFIK.L--------------------------
Q9U7L5_9TRYP/25-91NVGVVH.A--------------------------
Q9VTW6_DROME/5-72VVRYVQ.L--------------------------
RUXF_SCHPO/10-75NVLWVG.E--------------------------
LSM4_SCHPO/5-71NIKYLR.I--------------------------
HFQ_CLOPE/6-66AISTVS.P--------------------------
Q8RMG6_GLUDI/7-67AISTVM.P--------------------------
Q8VYI0_ARATH/5-74NIGVIG.E--------------------------
Q40942_BIGNA/8-70SIMSVS.K--------------------------
LSM5_YEAST/10-83NIAILV.P--------------------------
HFQ_CLOAB/7-67AVSTIT.P--------------------------
LSM3_YEAST/6-78TVTLIS.T--------------------------
RUXE_SCHPO/18-83NITLIQ.A--------------------------
LSM7_SCHPO/26-98TLVLIA.P--------------------------
LSMH_ENCCU/6-66NILFVG.P--------------------------
LSM1_YEAST/44-114NVVMLG.E--------------------------
Q9U1W8_CAEEL/19-97SVILVS.P--------------------------
RUXX_ARCFU/7-72TVVFVS.P--------------------------
SMD3_CAEEL/9-74KIRFMI.L--------------------------
SMD3_YEAST/9-74QIKFIV.V--------------------------
Q9VJI7_DROME/22-96ALVLIC.P--------------------------
Q96UB4_NEUCS/9-74NICMLI.P--------------------------
LSM7_YEAST/28-104ILVSLS.S--------------------------
HFQ_AQUAE/3-63AITTIV.P--------------------------
LSM2_ENCCU/5-70SIKYIL.V--------------------------
Q9SSF1_ARATH/5-70NIRYYI.L--------------------------
Q20229_CAEEL/12-80NVELAG.E--------------------------
RUXG_DROME/7-72SIVMVE.A--------------------------
RUXE_YEAST/19-92NITLIT.S--------------------------
Q8KNP9_BACTI/22-77AISTIR.F--------------------------
LSM6_YEAST/14-83QVMYIS.E--------------------------
RUXX_METAC/7-72NVVYVS.P--------------------------
Q8ZYG5_PYRAE/14-78NVLFIS.P--------------------------
LSM1_MOUSE/8-76NVVLLG.E--------------------------
Q9HPS2_HALSA/16-69NVVTIK.P--------------------------
RUXF_YEAST/17-83NVLYIR.E--------------------------
RSMB_CAEEL/7-82HIVSMT.V--------------------------
Q979R0_THEVO/6-70NVVRIV.P--------------------------
RUXF_NEUCR/10-76NVLYIK.K--------------------------
Q5JI86_PYRKO/5-71DMNWITLL--------------------------
Q8SRW7_ENCCU/7-67FIEDVV.V--------------------------
Q9AW42_GUITH/8-72NISMFI.I--------------------------
O96265_PLAF7/22-98SVILIL.R--------------------------
LSM3_SCHPO/12-90SVILIA.P--------------------------
RSMB_YEAST/10-97QILSTV.V--------------------------
RUXX_AERPE/11-75SVVVIT.P--------------------------
Q23543_CAEEL/14-87AITVVS.P--------------------------
RUXX_METTH/16-81NIVYIS.P--------------------------
Q96UG3_KLULC/5-69FIKYVN.L--------------------------
Q98S49_GUITH/5-70NILFIS.F--------------------------
LSM8_SCHPO/1-70NVAMVG.L--------------------------
RUXX_THEAC/12-77NVIFVS.P--------------------------
Q9FKB0_ARATH/12-80NIAILV.P--------------------------
RUXF_CAEEL/11-76NVLYVG.G--------------------------
SMD1_YEAST/5-97TIRQII.L--------------------------
Q97ZQ0_SULSO/10-75NVILIS.P--------------------------
LSM2_YEAST/5-72TVRYVY.L--------------------------
RUXX_PYRAB/7-72NVLAIS.P--------------------------
Q8LFL8_ARATH/13-81NVVLIG.E--------------------------
Q9CAX7_ARATH/8-72SIVTVE.A--------------------------
Q8SW39_ENCCU/8-72SIRFFV.L--------------------------
SMD1_CAEEL/5-70NIRYII.L--------------------------
RUXG_YEAST/5-73SIISLE.A--------------------------
LSM8_YEAST/3-66EIALVG.L--------------------------
SMD2_YEAST/34-106SVIVVL.K--------------------------
RUXE_DROME/22-88NITLIQ.N--------------------------
HFQ_THETN/8-69AISTIS.P--------------------------
SMD2_CAEEL/32-111SVILVV.K--------------------------
Q8SSM1_ENCCU/5-65SIRYVL.F--------------------------
NAA38_HUMAN/3-72NVAVIG.E--------------------------
Q9X393_BACAN/1-61AISTVS.L--------------------------
Q9GYZ4_9TRYP/37-105SVVFIV.R--------------------------
LSMD1_HUMAN/43-114HIVSIE.V--------------------------
Q92C58_LISMO/6-66AISTFS.P--------------------------
HFQ_BRUSU/6-66AISTIM.P--------------------------
LSM5_HUMAN/16-84NITMLV.P--------------------------
LSM10_MOUSE/19-84NVRYVH.I--------------------------
LSM1_SCHPO/14-82NVVLLG.E--------------------------
Q95XD4_CAEEL/3-72NVAIIG.E--------------------------
LSM4_CAEEL/6-72TIKYLR.I--------------------------
Q8SRU9_ENCCU/10-78NITMIG.L--------------------------
Q8SS46_ENCCU/16-80NIKRIC.E--------------------------
Q9W087_DROME/2-71NIAVIG.L--------------------------
LSM7_HUMAN/13-86SVVLIC.P--------------------------
Q9M0C7_ARATH/19-85NITLMM.N--------------------------
NAA38_YEAST/4-68SVKTIM.I--------------------------
Q9GYZ7_9TRYP/8-71NVLYIR.E--------------------------
Q9LMN4_ARATH/14-92GVILVS.P--------------------------
Q8TYS2_METKA/5-69SVTLIS.P--------------------------
Q9GYZ3_9TRYP/17-83NVGVIH.P--------------------------
O29885_ARCFU/6-72NVVLIQ.P--------------------------
Q9I9E5_DANRE/7-82NLVSMT.V--------------------------
Q99UG9_STAAM/5-65AISTYT.V--------------------------
HFQ_THEMA/7-67AISTII.P--------------------------
SMD1_SCHPO/5-70NIRYYI.L--------------------------
Q8SSB9_ENCCU/5-70SIRLVK.L--------------------------
Q8ZYP8_PYRAE/14-80QVIYVS.T--------------------------
Q9W2K2_DROME/11-79NVVLLG.E--------------------------
Q9LM92_ARATH/10-75KVRFMV.I--------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window