Sequence alignment for CL0543

PF00869

Q1P9U0_9FLAV/281-580-----------------------------------------SRCVHLENR-----------------DFVTGTQGTTLVT
Q20II4_9FLAV/1-296-----------------------------------------MRCIGISNR-----------------DFVEGVSGGSWVD
Q2TP99_9FLAV/281-576-----------------------------------------MRCVGIGNR-----------------DFVEGLSGATWVD
Q9DS45_9FLAV/14-312-----------------------------------------FNCLGTSNR-----------------DFVEGASGATWID
Q32ZD8_9FLAV/287-580-----------------------------------------LRCIGVENR-----------------DFIEGISGGTWVD
A0EKU7_9FLAV/277-570-----------------------------------------SKCVHLENR-----------------DIVTGTTGTSRVN
Q7TDX4_9FLAV/1-298-----------------------------------------FNCLGMGNR-----------------DFIEGASGATWVD
Q91B85_9FLAV/282-582-----------------------------------------TRCTHLQNR-----------------DFVSGIQGTTRVS
A1BY63_WNV/25-323-----------------------------------------FNCLGMSNR-----------------DFLEGVSGATWVD
Q80L05_9FLAV/76-371-----------------------------------------MRCVGVGNR-----------------DFVEGVSGGAWVD
Q5DSL2_9FLAV/281-574-----------------------------------------MRCVGVGNR-----------------DFVEGLSGATWVD
Q8VBN2_9FLAV/1-301-----------------------------------------TRCTHLENR-----------------DFVTGTQGTTRVS
A5YBK7_9FLAV/1-299-----------------------------------------MNCLGISNR-----------------DFVEGLSGGTWVD
Q2VSS4_9FLAV/1-294-----------------------------------------AHCIGITDR-----------------DFIEGVHGGTWVS
Q32ZD6_9FLAV/283-584-----------------------------------------IRCIGVSNR-----------------DFVEGVSGASWVD
Q9JAD5_9FLAV/268-560-----------------------------------------TQCVNIQKR-----------------DIIRGASDVSWFD
A0EKU5_9FLAV/278-571-----------------------------------------SRCVHLENR-----------------DIVTGVSGTSRIS
Q32ZD5_9FLAV/287-585-----------------------------------------IRCVGVENR-----------------DFIEGVSGGTWVD
Q32ZE0_9FLAV/293-593-----------------------------------------MRCIGVENR-----------------DFVEGLSGGTWVD
Q9J9C2_9FLAV/272-565-----------------------------------------STCVSVAKR-----------------DMIRGDLGTTWVD
Q7T918_9FLAV/297-587-----------------------------------------THCTNVEKR-----------------DFLQSTSGSSWTT
Q8JJZ3_9FLAV/270-562-----------------------------------------TNCVSIQKR-----------------DILRGSGSTTWFD
A0EKU2_9FLAV/281-581-----------------------------------------TKCTHLENR-----------------DFVTGVQGTTRVS
O40971_LIV/1-301-----------------------------------------SRCTHLENR-----------------DFVTGTQGTTRVT
A8B3I1_9FLAV/176-474-----------------------------------------FNCLGMSSR-----------------DFIEGASGATWVD
A0EKU6_9FLAV/282-582-----------------------------------------SRCTHLENR-----------------DFVEGVTGTTKVT
A0EKU1_9FLAV/277-570-----------------------------------------SRCVHLENR-----------------DFVTGTTGSSRVS
Q8QVE1_9FLAV/285-590-----------------------------------------GHCHDPEKF-----------------DIIE.AGGYTKMT
Q32ZD1_9FLAV/290-588-----------------------------------------FNCLGMQNR-----------------DFVEGVNGVEWID
Q32ZE1_9FLAV/291-588-----------------------------------------IRCIGVSNR-----------------DFVEGMSGGTWVD
Q32ZD9_9FLAV/288-578-----------------------------------------THCTSIENR-----------------DFLSGAQGTTWTS
A0EKU3_9FLAV/273-567-----------------------------------------SRCVHLENR-----------------DFVEGVQGHTLVN
Q80DN8_WNV/290-586-----------------------------------------FNCLGMSNR-----------------DFIEGASGATWVD
A1Y2M8_9FLAV/281-571-----------------------------------------THCLGIPKR-----------------DFIRGLDGNTWVS
Q8QL64_9FLAV/273-565-----------------------------------------TNCVTISQR-----------------EILKGVEGVTWFE

PF01589

POLS_SFV/751-1253PRAHAAS.VAETMAYLWDQNQALFWLEFAAPVACILIITYCLRNVLCCCKSLSFLVLLS........LG.ATARAYEHST
POLS_MAYAB/742-1242PKAHAAS.FAEGMAYLWDNNQSMFWMELTGPLALLILATCCARSLLSCCK.GSFLVAMS........IGSAVASAYEHTA
POLS_AURAV/748-1243QRTSADE.FTDTMGYLWQHSQTMFWIQLVIPLAAVITL...VRCCSCCL...PFLLVAS........PP.NKADAYEHTI
Q9PZX1_EEEV/740-1240KPTRADD.TLQVLNYLWNNNQNFFWMQTLIPLAALIVCMRMLRCLFCCGP..AFLLVCG........AL..GAATYEHTA
Q80S25_9VIRU/747-1240KGARAEQ.YEPTPWWVW............APAALVLLCG..LRKCLCL....TFLVILG........LASPPTQAYEHTA
P89913_SINDV/749-1246RPTSAEP.FSETMTYLWTNSQPFFWAQLCIPLAAIIVL...VRCCSCCL...LFLVVAG........AYLAKVDAFEHAT
Q80S37_9VIRU/763-1264PKARAAS.VPESMAYLWNENQTLFWMELAAPVAVLLIISYCLRHALLTCRGLSFLVLLS........IG..SAHAYEHTA
POLS_BFV/737-1238AKSARAD.TLDDFSYLWTNNQAMFWLQLASPVAAFLCLSYCCRNLACCMK..IFLGISG........LCVIATQAYEHST
A4L7I3_CHIKV/744-1247RTAKAAT.YQEAAVYLWNEQQPLFWLQALIPLAALIVLCNCLRLLPCCCKTLTFLAVMS........VGAHTVSAYEHVT
POLS_RRVT/752-1254PRANAAS.FAETMAYLWDENKTLFWMEFAAPAAALALLACCIKSLICCCKPFSFLVLLS........LG.ASAKAYEHTA
Q9IBP3_WEEV/738-1234RPTNAET.FGETLNHLWFNNQPFLWAQLCIPLAALIIL...FRCFSCCM...PFLLVAG........VCLGKVDAFEHAT
Q9YKC9_9VIRU/752-1250RTARAET.TWESLDHLWNHNQQMFWSQLLIPLAALIVVTRLLKCM.CCVV..PFLVLAG........AA..SVGAYEHAT
Q80S49_9VIRU/740-1237RPSHAET.VGETLTYLWSHNQPFLWAQLCIPVAALVIL...LRCASCCL...PFLLVAG........VCLGKVDAYEHAT
Q80S39_9VIRU/746-1248PSARAQG.LTSALGYLSD.NRILPWLELMLPVAGLVALCCCCRYALCCSRSLTILALTG........AGLACAQAYEHFV
Q80S41_9VIRU/748-1245RPTNAES.FTETMSYLWGNSQPFFWVQLLIPLAALILA...ARCCSCCI...PFLLVAG........VYLSKADAYEHAT
POLS_MIDDV/754-1257PRAKAAT.FAETAAYLWAENQTVFWMQFAIPVACFMIVTYCLRHLMLCCRTASFLVAVS........LGMGATQAYEHSV
POLS_SLDV/788-1315PGARADQPYLDIIAYLWTNSKVAFGLQCAAPVACMLIVTYALRHCRLCCN..SFLGVRGWSALLVILAYVQSCKAYEHTV

PF00869

Q1P9U0_9FLAV/281-580LVLELGGCV----TLSAEGKPSIDLWLENIHQDALAVTREYCLHAKLTNTKVAARCPTTGPATLSE----------EHQK
Q20II4_9FLAV/1-296IVLEHGSCV----TTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNE----------EQDK
Q2TP99_9FLAV/281-576VVLEHGSCV----TTMAKDKPTLDIELLKTEVTNPAVLLKLCIETKISNTTTDSRCPTQGEATLVE----------EQDA
Q9DS45_9FLAV/14-312LVLEGGSCV----TVMAPEKPTLDFKVMKMEATELATVREYCYEATLDTLSTVARCPTTGEAHNTK----------RSDP
Q32ZD8_9FLAV/287-580LVLEHGGCV----TVRAEGKPTLDIELTNSFATGMAETRKYCYECEVSKITTVNHCPQMGEAHNSA----------SSDP
A0EKU7_9FLAV/277-570VVLEKHACV----TIVADGKPSIDIWLDGIYQESPAKTREYCLSMELSNQKIDARCPSMGEAYLEE----------ENSR
Q7TDX4_9FLAV/1-298LVLEGDSCL----TIMANDKPTLDVRMINIEASQLAEVRSYCYHASVTDISTVARCPTTGEAHNEK----------RADS
Q91B85_9FLAV/282-582LVLELGGCV----TLTAEGKPSVDVWLDDIHQENPAKTREYCLHAKLASSKVVARCPAMGPATLPE----------EHQA
A1BY63_WNV/25-323LVLEGDSCV----TIMSKDKPTIDVKMMNMEAANLAEVRSYCYLATVSDLSTKAACPTMGEAHNDK----------RADP
Q80L05_9FLAV/76-371LVLEHGGCV----TTMAQGKPTLDFELTKTTAKEVALLRTYCIEASISNITTATRCPTQGEPYLKE----------EQDQ
Q5DSL2_9FLAV/281-574VVLEHGGCV----TTMAKNKPTLDIELQKTEATQLATLRKLCIEGKITNITTDSRCPTQGEATLPE----------EQDQ
Q8VBN2_9FLAV/1-301LVLELGGCV----TITAEGKPSIDVWLEDIFQESPAETREYCLHAKLTNTKVEARCPTTGPATLPE----------EHQA
A5YBK7_9FLAV/1-299IVLEGGSCV----TVMAKDKPTLDIKLIRMEAKDLATVRSYCYQATVTDSSTEARCPTMGEAHNSK----------SLDA
Q2VSS4_9FLAV/1-294ATLEQGKCV----TVMAPDKPSLDISLQTVAIDGPAEARKVCYSAVLTHVKINDKCPSTGEAHLAE----------ENDG
Q32ZD6_9FLAV/283-584LVLEHGTCV----TVMGENRPTIDIELLKTAASNMAHARAYCYEATISDTVMETRCPTQGEAVSDK----------KGDG
Q9JAD5_9FLAV/268-560VLLEKGACV----TISAQDKPSVDLWLDDVIQESLIEGRHYCTKASITDLKADARCPTQGEATMRE----------EHLD
A0EKU5_9FLAV/278-571VVLEDHACV----TIMADGKPSVDIWLDEIYQQSPAKTREYCVDMEISDQKVDARCPSMGEASLAE----------EHSK
Q32ZD5_9FLAV/287-585VVLEHGGCV----TIMAPDKPTIDLELTSTIAKSMAVTRTYCVQAQVSELSVETRCPTMGEAHNSK----------SSDA
Q32ZE0_9FLAV/293-593VVLEHGGCV----TVRVEGKPTLDFELVQTKATGLAAVRAYCYQAKVSDIQISAACPAVQLTENSK----------ATDS
Q9J9C2_9FLAV/272-565AFLEKGSCS----TLMVEDKPAVDVWLDEVSQSSVIASHEYCMEVAGSNVKSSGSCPTQGEAHLAE----------EANS
Q7T918_9FLAV/297-587VVLEHGGCV----TLSAKDKPSVDVWLSSVTINNPPLTRKVCYKATLSEHKTANHCPTAGEAFLDE----------ESDD
Q8JJZ3_9FLAV/270-562VLLEKGSCV----TIVADDRPTVDIWLDRITHESPIAGREYCMRVDISGLKIATRCPTLGEAYLSE----------EHTE
A0EKU2_9FLAV/281-581LVLELGGCV----TITAVDKPSVDVWLDEIYQEEPATTREYCLQAKLGAAKVAARCPTMGPATLTE----------EHQV
O40971_LIV/1-301LVLELGGCV----TITAEGKPSMDVWLDAIYQESPAKTREYCLHAKLSETKVAARCPTMGPAVLTE----------EHQI
A8B3I1_9FLAV/176-474LVLEGDSCI----TIMAADKPTLDIRMMNIEATNLALVRNYCYAAIVSDVSTVSNCPTTGESHNTK----------RADH
A0EKU6_9FLAV/282-582LVLELGGCV----TVTAEGRPSVDVWLDSIYQESLAQVREYCLHAKLSNSKVAARCPTMGPATLPE----------EHQA
A0EKU1_9FLAV/277-570VVLEKHACV----TIVAEGKPSLDVWLDSIFQESPAPTREYCLDMGIFDQKVEARCPTMGEAHLDE----------EHQT
Q8QVE1_9FLAV/285-590TFLKHDKCF----MVRVPEHDVVEITVVKKTIRPTTGCKTFLLGASV.NTESRAKCPGAGSATIPK----------TPGD
Q32ZD1_9FLAV/290-588VVMEGGSCV----TITAKDKPTIDVKMMNMEATDLALVRSYCYEPKITDVSTEPRCPTMGEAHNTK----------ANNQ
Q32ZE1_9FLAV/291-588VVLEHGGCV----TVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDK----------QSDT
Q32ZD9_9FLAV/288-578VVLEHGGCV----TLTSDDKPSLDIWLDSVTINGPPLVRKVCYDANISDQKTANKCPTTGEAILDE----------EHEV
A0EKU3_9FLAV/273-567IVVEEGGCV----TITAHDRPSIDVWLKGISQESPAKSREYCLKPKLGNAKTEARCPTMGEATLAE----------EHSA
Q80DN8_WNV/290-586LVLEGDSCV----TIMAKDRPTIDVKMVTMGASNMAEVRSYCYAASATEISSSAACPTMGEAHNEK----------RTDS
A1Y2M8_9FLAV/281-571VVLEQGGCV----TLIADNKPSVDVWLSSIVVDTPTLVRKICYESSVTGSKAEGACPTMGDAHLTE----------EGNE
Q8QL64_9FLAV/273-565VLLEKTSCI----TIAAQNRPSIDLWLDDVKQSSVMASKEFCMKVEVSETQIAARCPTQGDATLPM----------EGKD

PF01589

POLS_SFV/751-1253VMPNVVGFP.YKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYVKCCGASECST..........KEKP
POLS_MAYAB/742-1242IIPNQVGFP.YKAHVAREGYSPLTLQMQVIETSLEPTLNLEYITCDYKTKVPSPYVKCCGTAECRT..........QDKP
POLS_AURAV/748-1243TVPNAPLNS.YKALVERPGYAPLNLEVMVMNTQIIPSVKREYITCRYHTVVPSPQIKCCGTVECPK..........GEKA
Q9PZX1_EEEV/740-1240VMPNKVGIP.YKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVVKCCGATQCTS..........KPHP
Q80S25_9VIRU/747-1240VMSNQVGVP.YKALINKPGFAPMILQIEVLQSSLIPSLELDYITCEYKTVVPSPFVKCCGSVECTG..........RSMP
P89913_SINDV/749-1246TVPNVPRIP.YKALVERAGYAPLNLEITVMSSELIPSTNLEYVTCKYTTVVPSPKVKCCGTLECSS..........ARHA
Q80S37_9VIRU/763-1264VMPNMVGFP.YKAHVDRSGFSPLTLQMQVVETSLEPSLNLEYITCDYKTVVPSPFIKCCGNTECKT..........KAKP
POLS_BFV/737-1238TMPNQVGIP.FKALIERPGYAGLPLSLVVIKSELVPSLVQDYITCNYKTVVPSPYIKCCGGAECSH..........KNEA
A4L7I3_CHIKV/744-1247VIPNTVGVP.YKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECKD..........KSLP
POLS_RRVT/752-1254TIPNVVGFP.YKAHIERNGFSPMTLQLEVVETSWEPTLNLEYITCEYKTVVPSPFIKCCGTSECSS..........KEQP
Q9IBP3_WEEV/738-1234TVPNVPGIP.YKALVERAGYAPLNLEIKVVSSELTPSTNKEYVTCKFHTVIPSPQVKCCGSLECKA..........SSKA
Q9YKC9_9VIRU/752-1250TMPNQVGIP.YNTVVNRAGYAPLAISIIPTKIRLIPTLNLEYITCHYKTGLDSPFIKCCGTQECPK..........VNRP
Q80S49_9VIRU/740-1237TVPNVPGVP.YKALVERSGYAPLNLEVMVVSSELVPTVNKEYITCKFHTVIPSPKIKCCGILECSA..........QQRA
Q80S39_9VIRU/746-1248TIPNHVGFP.YMAHVERPGYRPLTLKLVVEETSLEPTLNQEYITCEYKTMVPSPYVKCCGSTECQT..........KEQA
Q80S41_9VIRU/748-1245TVPNVPQIP.YKALVERAGYAPLNLEITVVSSVIIPSVQQEYITCKYTTVVPSPQVKCCGALECKP..........SALA
POLS_MIDDV/754-1257TLPNAVGFP.YRAHVDRPGFSPLTLHMEVVSTSLEPTLALDYVTCEYKTVVPSPKVTCCGMSECAH..........QQKA
POLS_SLDV/788-1315VVPMDPRAPSYEAVINRNGYDPLKLTIAVNFTVISPTTALEYWTCAGVPVVEPPHVGCCTSVSCPSDLSTLHAFTGKAVS

PF00869

Q1P9U0_9FLAV/281-580NMVCK--RDQSDRGWGNHCGLFGKGSIVGCTKF-----DCET.NKKATGKVFDITKIVYTVKVEPHTGT-YVAANE....
Q20II4_9FLAV/1-296RFVCK--HSMVDRGWGNGCGLFGKGGIVTCAMF-----TC...KKNMEGKVVQPENLEYTIVVTPHSGE-EHAVGND...
Q2TP99_9FLAV/281-576NFVCR--RTFVDRGWGNGCGLFGKGSLLTCAKF-----KC...VTKLEGKIVQYENLKYTVIVTVHTGD-QHQVGNE...
Q9DS45_9FLAV/14-312TFVCK--RDVVDRGWGNGCGLFGKGSIDTCAKF-----TC...KNKATGKTILRENIKYEVAIFVHGST-DSTSHGNYSE
Q32ZD8_9FLAV/287-580KQVCK--KGYSDRGWNNGCGLFGKGSLETCAEF-----AC...KKEAPGHVIRKENLEYNVMVAVHGSV-PSENAGN...
A0EKU7_9FLAV/277-570DNVCH--RDYSDRGWGNHCGLFGKGSIVGCVKV-----TCTS.GKTLQGLEFDANKITYAVHLEVHDGV-MRTLNN....
Q7TDX4_9FLAV/1-298SYVCK--QGFTDRGWGNGCGLFGKGSIDTCAKF-----SC...TSKAIGRMIQPENIKYEVGIFVHGTT-TSENHGNYSA
Q91B85_9FLAV/282-582STVCR--RDQSDRGWGNHCGLFGKGSIVACAKF-----ACEA.KKKATGYVYDVNKITYVVKVEPHTGD-YLAANE....
A1BY63_WNV/25-323AFVCR--QGVVDRGWGNGCGLFGKGSIDTCAKF-----AC...STKAIGRTILKENIKYEVAIFVHGPT-TVESHGNYST
Q80L05_9FLAV/76-371QYICR--RDVVDRGWGNGCGLFGKGGVVTCAKF-----SC...SGKITGNLVQIENLEYTVVVTVHNGD-THAVGND...
Q5DSL2_9FLAV/281-574NYVCK--HTYVDRGWGNGCGLFGKGSLVTCAKF-----QC...LEPIEGKVVQHESLKYTVTITVHTGD-EHQVGND...
Q8VBN2_9FLAV/1-301NMVCK--RDQSDRGWGNHCGFFGKGSIVACAKF-----ECEE.AKKAVGHVYDSTKITYVVKVEPHTGD-YLAANE....
A5YBK7_9FLAV/1-299SYVCK--SSYVDRGWGNGCGLFGKGSIQTCVKF-----SC...PGKATGKSIQRENLNYDVAVYVHGPI-SAAAHGNYTA
Q2VSS4_9FLAV/1-294DNACK--RTYSDRGWGNGCGLFGKGSIVACAKF-----TC...AKSMSLFEVDRTKIQYVIRAQLHVGA-KQEN......
Q32ZD6_9FLAV/283-584NYLCK--KGYNDRGWGNGCGLFGKGSYMSCTKF-----EC...KKHTKAQIILPENLAYDVAIAVHSSQ-GAVHIDNEIA
Q9JAD5_9FLAV/268-560GYVCK--RSFSDRGWGNGCGLFGKGSIVGCAKA-----TCGA.NDIIKSYSYDSPKVKYVIGAEVHQGK-LLTNN.....
A0EKU5_9FLAV/278-571DYLCR--RDYSDRGWGNHCGLFGKGSIVGCTKV-----TCAV.GKSLQGYELDATKITYAVHVEAHDSI-MRTTNV....
Q32ZD5_9FLAV/287-585AYVCK--KGFSDRGWGNGCGLFGKGSMETCAKF-----SC...QTKAEGRIIQRENLEYTIHMNVHASQ-ETGHFMNDTI
Q32ZE0_9FLAV/293-593NYLCR--RGVTNRGWNNGCGLFGKGDIHTCVKF-----KC...EKKAAGFSIGKENLEYEVRASVHNSI-GADKFSNELA
Q9J9C2_9FLAV/272-565DYVCK--RGFSDRGWGNGCGLFGKGSIVACIKT-----TCKNDANIIKSYVYDAPKIQFTVGIEVHKGN-LLGPS.....
Q7T918_9FLAV/297-587QHICK--RGFSDRGWGNGCGLFGKGSIVACSKF-----TC...NHDMHLMEIDQNKIHFKVTAQVHTSE-RDAT......
Q8JJZ3_9FLAV/270-562DYVCK--RGFSDRGWGNGCGLFGKGSIVGCVKT-----TCKS.SGIAKSYSYDIPKVKYVISTEVHKGE-LISGN.....
A0EKU2_9FLAV/281-581NTVCK--RDQSDRGWGNHCGLFGKGSIVACAKF-----SCEE.RKTVVGHVYDVNKIIYVVKVEPHTGD-HKPMND....
O40971_LIV/1-301GTVCK--RDQSDRGWGNHCGLFGKGSIVACVKA-----ACEA.KKKAMGYVYDANKIVYTVKVEPHTGD-YVAANE....
A8B3I1_9FLAV/176-474NYLCK--RGVTDRGWGNGCGLFGKGSIDTCAKF-----TC...SSSAAGRLILPENIKYEVGIFVHGST-DSTSHGNYST
A0EKU6_9FLAV/282-582DMVCK--RDQSDRGWGNHCGLFGKGSIVACTKF-----TCEE.KRTAAGYVFDSSKVTFAVKVEPHTGT-YLAAND....
A0EKU1_9FLAV/277-570GHLCR--RDYSDRGWGNHCGLFGKGSIVGCVRV-----NCTA.GKTLKGLEFDSTKITYAVHLEAHDGQ-MVPLNE....
Q8QVE1_9FLAV/285-590KTFCH--IEHVDRGWDSGCFIFGKGEVVTCAAV-----TY...SKPFYAWMVDSEQITWEVEVNFGG..-..........
Q32ZD1_9FLAV/290-588EYVCK--KGYTDRGWGNGCGLFGKGSIHTCAKF-----EC...TNKAEGRIVQKENVHFELAVFVHGST-EMGTYNDYFI
Q32ZE1_9FLAV/291-588QYVCK--RTLVDRGWGNGCGLFGKGSLVTCAKF-----TC...SKKMTGKSIQPENLEYRIMLSVHGSQ-HSGMIGYE..
Q32ZD9_9FLAV/288-578EYECK--RGFSDRGWGNGCGLFGKGSIVACAKF-----AC...AHDMQLHEIGQDKVHFVIKLQLHTSE-RDST......
A0EKU3_9FLAV/273-567SYVCE--RGFSDRGWGNNCGLFGKGSIVGCVKF-----SCEA.SAVLTGLVYDATKIVYEVGVEVHTGM-TNEPNK....
Q80DN8_WNV/290-586NFVCK--QGVVDRGWGNGCGLFGKGSIDTCAKF-----TC...SNKATGLTIQRENVKYEVAVSVHGPT-TVDTH..MSA
A1Y2M8_9FLAV/281-571EWECK--RSFSDRGWGNGCGLFGKGSIVACAKF-----SC...TKEMEVYQIDSTKIEYTISAQVHSGA-KKED......
Q8QL64_9FLAV/273-565DYVCK--KTFSDRGWGNGCALFGKGSIVGCAKV-----ACNT.ANVMKTHIYEQQAVQYVVGIEVHRGE-VIKAN.....

PF01589

POLS_SFV/751-1253DYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHD..HASAYKAHTASLKAKVRVMYGNVN.QTVDVYVNGD
POLS_MAYAB/742-1242EYKCAVFTGVYPFMWGGAYCFCDSENTQMSEAYVERADVCKHD..HAAAYRAHTASLRAKIKVTYGTVN.QTVEAYVNGD
POLS_AURAV/748-1243DYTCKVFTGVYPFLWGGAQCFCDSENSQLSDKYVELSTDCATD..HAEAVRVHTASVKSQLRITYGNST.AQVDVFVNGV
Q9PZX1_EEEV/740-1240DYQCQVFTGVYPFMWGGAYCFCDTEDTQMSEAYVERSEECSID..HAKAYKVHTGTVQAMVNITYGSVSWRSADVYVNGE
Q80S25_9VIRU/747-1240DYQCRVDSGVYPYMWGGAYCFCSSENTQMSEAYVERAEVCKHE..HALAYKTQTASLTATLKVTLGNIT.QGAKAYVNGE
P89913_SINDV/749-1246DYNCKVFGGVYPFMWGGAQCFCDSENSQMSEAYVEFSADCAAD..HAQAVKVHTAALKVGLRVVYGNTT.SMLDVYVNGV
Q80S37_9VIRU/763-1264DYRCQTYTGVYPFLWGGAYCFCDTENTQMSEAYVDRADVCKHD..HAAAYKAHTTSLKAKILISYGTVN.QTVEAFVSGE
POLS_BFV/737-1238DYKCSVFTGVYPFMWGGAYCFCDTENSQMSEVYVTRGESCEAD..HAIAYQVHTASLKAQVMISIGELN.QTVDVFVNGD
A4L7I3_CHIKV/744-1247DYSCKVFTGVYPFMWGGAYCFCDTENTQLSEAHVEKSESCKTE..FASAYRAHTASASAKLRVLYQGNN.VTVSAYANGD
POLS_RRVT/752-1254DYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCKHD..HASAYKAHTASLKATIRISYGTIN.QTTEAFVNGE
Q9IBP3_WEEV/738-1234DYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPDCTID..HAVALRVHTAALKVGLRIVYGNTT.AYLDTFVNGV
Q9YKC9_9VIRU/752-1250DEQCKVFTGVYPFMWGGAYCFCDSENTQISRAYVMKSDDCSAD..HALAYKAHTASVQAFLNITVGEQS.TTAVVYVNGE
Q80S49_9VIRU/740-1237DYACRVFGGVYPFMWGGAQCFCDTENTQMSEAYVVLSPDCKAD..HAVALKVHTASLKVNLRITYGNTT.TNVITFVNGV
Q80S39_9VIRU/746-1248DYQCKVYTGVYPFMWGGAYCFCDAENSQLSEAYVVRSEMCKLD..HAVAYRAHTASLKAKVRVSIGSVN.QTVETFVNGE
Q80S41_9VIRU/748-1245DYNCKTFGGVYPFMWGGAQCFCDTENTQMSEAYVERSSDCAVD..HAQALKVHTSSMKVGLKITYGNTT.GMLDVFVNGV
POLS_MIDDV/754-1257DFQCKVYTGVYPFLWGGAYCFCDSENTQLSEAYVERSEVCKHD..HAAAYRAHTAALKAKISVTYGSTN.GTAEAFVNGE
POLS_SLDV/788-1315DVHCDVHTNVYPLLWGAAHCFCSTENTQVSAVAATVSEFCAQDSERAEAFSVHSSSVTAEILVTLGEVV.TAVHVYVDGV

PF00869

Q1P9U0_9FLAV/281-580..THSDRKTVAFTAQS---------------EKKTISMGNY..GEVGLSCRVNSGID----VDQTVVLELESQALH.PKG
Q20II4_9FLAV/1-296..TGKHGKEIKVTPQS---------------SITEAELTGY..GTVTMECSPRTGLD----FNEMVLLQME......DKA
Q2TP99_9FLAV/281-576..STEHGTTATITPQA---------------PTSEIQLTDY..GALTLDCSPRTGLD----FNEMVLLTMK......EKS
Q9DS45_9FLAV/14-312QIGKNQAARFTISPQA---------------PSFTANMGEY..GTVTIDCEARSGIN----TEDYYVFTVK......EKS
Q32ZD8_9FLAV/287-580..DTSHAVKLSFTTAS---------------PVATGKLGDF..GEVSMECEPRSGLD----FEQYYMFTID......KNS
A0EKU7_9FLAV/277-570..LNTLRKTSLFTAAS---------------EKHVVSINQF..GQATIQCRVNSGID----LAKTMLVQMG......DDV
Q7TDX4_9FLAV/1-298QVGASQAAKFTVTPNA---------------PSITLKLGDY..GEVTLDCEPRSGLN----TEAFYVMTVG......SKS
Q91B85_9FLAV/282-582..SHSNRKTASFTTQS---------------EKTILTLGDY..GDISLTCRVTSGVD----PAQTVVLELDKTAEHLPKA
A1BY63_WNV/25-323QAGATQAGRFSITPAA---------------PSYTLKLGEY..GEVTVDCEPRSGID----TNAYYVMTVG......TKT
Q80L05_9FLAV/76-371..TSNHGVTATITPRS---------------PSVEVKLPDY..GELTLDCEPRSGID----FNEMILMKMK......KKT
Q5DSL2_9FLAV/281-574....TQGVTVEITPQA---------------STVEAVLPEY..GTLGLECSPRTGLD----FNEMILLTMK......NKA
Q8VBN2_9FLAV/1-301..TNSNRKSAQFTVAS---------------EKVILRLGDY..GDVSLTCKVASGID----VAQTVVMSLDSSKDHLPSA
A5YBK7_9FLAV/1-299QLTGKYAAKFSITPSA---------------PTYTANLGEY..GEATMECEPRAALD----IDNYYVMSLN......NKH
Q2VSS4_9FLAV/1-294..WNTDIKTLKFDALS---------------GSQEAEFTGY..GKATLECQVQTAVD----FGNSYIAEME......KDS
Q32ZD6_9FLAV/283-584QATEEHKAKITFTPQA---------------PTAEVDLKSY..GTMTMTCEAQSGLD----FSQLYLMTLD......KKH
Q9JAD5_9FLAV/268-560..STDRIVKTTLTAES---------------EKHTITIADY..GSMDFTCRVVASAE----LSNIRMIELD......GHM
A0EKU5_9FLAV/278-571..RNPARKTAQVTAAS---------------EKHVIDLAKF..GEISLECRVSSGLD----LAKTVVVEMG......EQV
Q32ZD5_9FLAV/287-585ASENKHGAKISITATG---------------PSRTADLGDY..GMVTLDCEPRAGLD----FDNLYLLTLG......RNS
Q32ZE0_9FLAV/293-593D.GEPHTQKMKFSPLS---------------PSAEKSFGDY..GTLGMDCEPQSGLD----FGQLYLMTIE......SKS
Q9J9C2_9FLAV/272-565..DNNRIVKATFSAEA---------------GKHSVELTGY..GVLEFSCRVVASTD----LSDIRLIEID......NHF
Q7T918_9FLAV/297-587..SKEWKRETEFTMAS---------------GPQVIGFAGY..GTATVSCNLKTSMD----LNNYYVSKMA......DEY
Q8JJZ3_9FLAV/270-562..VSASVVSATFSSEA---------------EKHSMELEDY..GRLEFTCRVVSGSN----LGSVRILEID......NHY
A0EKU2_9FLAV/281-581..TPSTRKTASFTAAA---------------EKEIISLGDY..GDLSLVCRVNSGVD----LAQTVVMEMNRTTSHLPKA
O40971_LIV/1-301..THKGRKTATFTVSS---------------EKTILTLGEY..GDVSLLCRVASGVD----LAQTIILELDKTAEHLPTA
A8B3I1_9FLAV/176-474QIGANQAARFTISPNA---------------PAITAKMGDY..GEVTVECEPRSGLN----TEAYYVMTIG......TKH
A0EKU6_9FLAV/282-582..THVDRKEAKFTAAA---------------EKVILTLGDY..GDMSLVCRVTSGMD----MAQTVILEMDKTNEHLPQA
A0EKU1_9FLAV/277-570..SNTGRKTALVTVAS---------------EKHVSTIAGF..GSVTIECRVSSGVD----LAKTMLIEMN......DNV
Q8QVE1_9FLAV/285-590..DSNRKKTAEISMDS---------------EYEEFEDPKNTGSKIRLYCK.TPRQE----WDNYYMVARPG.....GSL
Q32ZD1_9FLAV/290-588QQSLKQAARFIVTPKA---------------PVYTAELNEY..GTVTLECEPRSGMD----MSQFYVLTMN......SKS
Q32ZE1_9FLAV/291-588..TDEDRAKVEVTPNS---------------PRAEATLGGF..GSLGLDCEPRTGLD----FSDLYYLTMN......NKH
Q32ZD9_9FLAV/288-578..SADWKRSIEFNMLS---------------GQQVVVFTGY..GTVTLSCNLKTTMD----LGNYYIAILG......SDR
A0EKU3_9FLAV/273-567..TTGTVKILQFTSQA---------------EKKVASLGDH..GELTVECRVNSGID----VSHTILMELS......GKV
Q80DN8_WNV/290-586QNAAVQAGRFSVSPAA---------------PTHTLTLGDY..GEVTFDCEPRSGVD----VDAFYVMTVG......TKS
A1Y2M8_9FLAV/281-571..WVNHTKLIKFVPTT---------------GTSTVTFTGY..GNFGLECHVQMMVD----LGNSYLVKVG......TDA
Q8QL64_9FLAV/273-565..VSDKVIKASFSAEA---------------EKHTVEIPDY..GSLDFTCRVVASAD----LSNIRLLEVD......GHY

PF01589

POLS_SFV/751-1253HAVTIGGTQFIFGPLSSAWTPFDNKIVVYKDEVFNQDFPPYGSGQPGRFGDIQSRTVE...SNDLYA----------NTA
POLS_MAYAB/742-1242HAVTIAGTKFIFGPVSTPWTPFDTKILVYKGELYNQDFPRYGAGQPGRFGDIQSRTLD...SRDLYA----------NTG
POLS_AURAV/748-1243TPARSKDMKLIAGPLSTTFSPFDNKVIIYHGKVYNYDFPEFGAGTPGAFGDVQASSTT...GSDLLA----------NTA
Q9PZX1_EEEV/740-1240TPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAGSFGDLQSRTST...SNDLYA----------NTN
Q80S25_9VIRU/747-1240TPFQIGQAKFVLGPISAAWSPFNPKIVVYKDDVYNYDFPAYGAGQPGRFGDIQSRTVD...SKDLYA----------RTH
P89913_SINDV/749-1246TPGTSKDLKVIAGPISAAYTPFDHKVIIHKGKVYNYDFPEYGAMKPGAFGDIQATSLT...SSDLIA----------NTD
Q80S37_9VIRU/763-1264QAVNVAGTRFIFGPLSSAWTPFDTKIVVYKDEVYNLDFPPYGSGQPGRFGDIQSRTTT...SADVYA----------NTG
POLS_BFV/737-1238SPARIQQSKFILGPISSAWSPFDHKVIVYRDEVYNEDYAPYGSGQAGRFGDIQSRTVN...STDVYA----------NTN
A4L7I3_CHIKV/744-1247HAVTVKDAKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPE...SEDVYA----------NTQ
POLS_RRVT/752-1254HAVNVGGSKFIFGPISTAWSPFDNKIVVYKDDVYNQDFPPYGSGQPGRFGDIQSRTVE...SKDLYA----------NTA
Q9IBP3_WEEV/738-1234TPGSSRDLKVIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMKPGAFGDIQASSLD...ATDIVA----------RTD
Q9YKC9_9VIRU/752-1250TPVNFNGIKLVAGPLSTAWTPFDRKVVQYAGEIYNYDFPEYGAGHAGAFGDLQARTIT...SNDLYA----------NTN
Q80S49_9VIRU/740-1237TPGISGALKVIAGPISAAFTPFDNKVVINKGLVYNYDFPEYGAMKPGAFGDIQASTID...GRDLVA----------RTD
Q80S39_9VIRU/746-1248SKAKVSGISMILGPVSTAWTPFDNKIVVYKDEVFNQDFPPYGSGQPGRFGDIQSRTTT...SKDLYA----------NTA
Q80S41_9VIRU/748-1245TPGTSKDLKVIAGPISAAFSPFDSKVVVYKGMVYNYDFPEFGAMKPGVFGDIQASSPT...SNDLVA----------NTD
POLS_MIDDV/754-1257STARIGDLKMILGPISTAWSPFDPKIVVYKDEVYNQDYPPYGSGQPGRFGDLQSRTTE...SNDVYA----------NTA
POLS_SLDV/788-1315TSARGTDLKIVAGPITTDYSPFDRKVVRIGEEVYNYDWPPYGAGRPGTFGDIQARSTNYVKPNDLYG----------DIG

PF00869

Q1P9U0_9FLAV/281-580WAVHKDWFNDLALPWK.....HHEAEV...WESKERLVEFGPPHAVKMDVFNLGDQTGIL--------------------
Q20II4_9FLAV/1-296WLVHRQWFLDLPLPWL.....PGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAM--------------------
Q2TP99_9FLAV/281-576WLVHKQWFLDLPLPWT.....SGATTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAM--------------------
Q9DS45_9FLAV/14-312WLVNRDWFHDLNLPWT.....SPATTD...WRNRETLVEFEEPHATKQTVVALGSQEGAL--------------------
Q32ZD8_9FLAV/287-580WLVDRSWFHDLNLPWK.....GGSAGD...WQNKQSMVEFAEPHATKQDVLALGSQEGAL--------------------
A0EKU7_9FLAV/277-570WSVHRDWFEDLPYPWR.....H.GGTS...WREVSRVVGFEPPHAVKMTAHSLGDQTGAV--------------------
Q7TDX4_9FLAV/1-298FLVHREWFHDLSLPWT.....SPSSTA...WRNRELLMEFEEAHATKQSVVALGSQEGGL--------------------
Q91B85_9FLAV/282-582WQVHRDWFEDLSLPWR.....HEGAHE...WNHADRLVEFGEPHAVKMDIFNLGDQTGIL--------------------
A1BY63_WNV/25-323FLVHREWFMDLNLPWS.....SAGSTV...WRNRETLMEFEEPHATKQSVIALGSQEGAL--------------------
Q80L05_9FLAV/76-371WLVHKQWFLDLPLPWT.....AGADTSEVHWNYKERMVTFKVPHAKRQDVTVLGSQEGAM--------------------
Q5DSL2_9FLAV/281-574WMVHRQWFFDLPLPWT.....SGATTETPTWNRKELLVTFKNAHAKKQEVVVLGSQEGAM--------------------
Q8VBN2_9FLAV/1-301WQVHRDWFEDLALPWK.....HKDNQD...WNSVEKLVEFGPPHAVKMDVFNLGDQTAVL--------------------
A5YBK7_9FLAV/1-299WLVNRDWFHDLDLPWT.....GPATES...WKNRESLIEFEEPHATRQTVVALGNQEGAL--------------------
Q2VSS4_9FLAV/1-294WIVDRQWAQDLTLPWQ.....SGSGGT...WREMHHLVEFEPPHAATIRVLALGNQEGSL--------------------
Q32ZD6_9FLAV/283-584WLVNREWYHDLDLPWM.....AGEDARYKYWNNKEALVEFRDAHAKKQEVVVLGSQEGAL--------------------
Q9JAD5_9FLAV/268-560FNVHEDWLSDLPLPSK.....I.SGGS...WHGMDRLVVFKEPHAVKMEIQECGDQRPAV--------------------
A0EKU5_9FLAV/278-571WSVHRDWFEDLPYPWR.....H.DENA...WRDAHRVVGFEPPHAVKMVAYALGDQTGTV--------------------
Q32ZD5_9FLAV/287-585WLVNRDWFHDVNLPWI.....GGAEGH...WKNRESLVEFGKTHATKREVLALGSQEGTL--------------------
Q32ZE0_9FLAV/293-593WLVNRDWYHDLHLPYT.....VGSGSQ...WNNREALVEFQEPHATKQEVLALGSQEGAL--------------------
Q9J9C2_9FLAV/272-565YNVHEDWLRDLPLPWR.....L.PKGK...WKDMERMVVFKDPHAVKWTVQTYGNQRTAI--------------------
Q7T918_9FLAV/297-587FLLNKQWVMDLPLPWT.....PATATS...WREKHYLTHFDEPHATTVTVTSMGNQEGSL--------------------
Q8JJZ3_9FLAV/270-562FNVHEDWLLDLPLPWR.....I.PDGH...WHDLGKLIAFKEPHAVKMVVQAYGDQRASL--------------------
A0EKU2_9FLAV/281-581WQVHRDWFEDLALPWR.....HVGAET...WNYPERLVEFGVPHAVKMDVYTLGDQMGTM--------------------
O40971_LIV/1-301WQVHRDWFNDLALPWK.....HVGNPH...WNNAERLVEFGAPHAVRMDVYNLGDQTGVL--------------------
A8B3I1_9FLAV/176-474FLVHREWFNDLLLPWT.....SPSSTE...WRNREILMEFEEPHATKQSVVALGSQEGAL--------------------
A0EKU6_9FLAV/282-582WQVHRSWFEDLSLPWR.....HKGESA...WREAQRLVEFGPPHAVKMDVYNLGDQTSVM--------------------
A0EKU1_9FLAV/277-570WSVHRDWFEDLPYPWR.....H.GDNP...WRDAGRLVGFEPPHAVKMVAYTLGDQTGTV--------------------
Q8QVE1_9FLAV/285-590YKVRRELINDLNLPWTDFKYPYVTTTI...VRNGESILRFKRPTMTYIPVTVAAGLERLY--------------------
Q32ZD1_9FLAV/290-588WLVNRDWFHDLNLPWT.....GSSAGS...WQNRESLVEFEEAHATKQSVVALASQEGAL--------------------
Q32ZE1_9FLAV/291-588WLVHKEWFHDIPLPWH.....AGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAV--------------------
Q32ZD9_9FLAV/288-578FLVNKNWATDLPLPWT.....PASADA...WREKHYLVHFEEPHATSVAVTTLGDQEGAV--------------------
A0EKU3_9FLAV/273-567WNVHRDWFMDLPFPWR.....HGGGDT...WNDKKRLVEFEPPHAVKMVAVSLGDQTGVV--------------------
Q80DN8_WNV/290-586FLVHREWFMDLNLPWS.....SPGNTN...WRNREALVEFEEAHATKQSVVALGSQEGAL--------------------
A1Y2M8_9FLAV/281-571WLVNKQWAHDITLPWQ.....SGTGGH...WRDKHFMVDFEQPHAVTMKALVLGSQEGAL--------------------
Q8QL64_9FLAV/273-565FNVHEDWLDDLPLPWR.....I.NAGP...WRGMDKLVNFREPYAVKMVIMGYGDQRPAV--------------------

PF01589

POLS_SFV/751-1253LKLARPSPGMVHVPYT-----QTPSGFKYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEA
POLS_MAYAB/742-1242LKLARPAAGNIHVPYT-----QTPSGFKTWQKDRDSPLNAKAPFGCIIQTNPVRAMNCAVGNIPVSMDIADSAFTRLTDA
POLS_AURAV/748-1243IHLQRPEARNIHVPYT-----QAPSGFEFWKNNSGQPLSDTAPFGCKVNVNPLRADKCAVGSLPISVDIPDAAFTRVSE.
Q9PZX1_EEEV/740-1240LKLQRPQAGIVHTPFT-----QAPSGFERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISET
Q80S25_9VIRU/747-1240LRLDRPASGNIHVPYT-----QIPSGFKYWMQEKGEPLNRQAAFGCVVKTNPVRADNCAYGNIPISVDIPDAMFTRVVDI
P89913_SINDV/749-1246IRLLKPSAKNVHVPYT-----QAASGFEMWKNNSGRPLQETAPFGCQIAVNPLRAIDCAYGNIPISVDIPNAAFVRVSDA
Q80S37_9VIRU/763-1264LKLLRPASGNVHVPYT-----QTPSGFKYWLKERGRALNAVAPFGCIIKTNPVRAMNCAVGNIPVSMDIPDSAFTRVVDA
POLS_BFV/737-1238LKLKRPASGNVHVPYT-----QTPSGFSYWKKEKGVPLNRNAPFGCIIKVNPVRAENCVYGNIPISMDIADAHFTRIDES
A4L7I3_CHIKV/744-1247LVLQRPSAGTVHVPYS-----QAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAMNCAVGNMPISIDIPDAAFTRVVDA
POLS_RRVT/752-1254LKLSRPSPGVVHVPYT-----PTPSGFKYWLKEKGSSLNTKAPFGCKIKTNPVRAMDCAVGSIPVSMDIPDSAFTRVVDA
Q9IBP3_WEEV/738-1234IRLLKPSVKNIHVPYT-----QAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASNCAYGHIPISIDIPDAAFVRSSES
Q9YKC9_9VIRU/752-1250LVLQRPNTGTIHVPYT-----QAPSGFEQWKKDKPPSLKYTAPFGCEIHVNPVRAENCAVGFIPLAFDIPDALFTRVSET
Q80S49_9VIRU/740-1237IRLLKPSAKNIHVPFT-----QAASGYEMWKNNSGRPLQDTAPFGCRIAVDPLRAENCTYGSIPISLDIPDATFLRVSDS
Q80S39_9VIRU/746-1248LKLARPSAGTIHVPYT-----QTPSGFRYWLKEKGSALNSKAPFGCIIKTGPVRAMNCAVGNMPVSLDLPDAVFTRITDS
Q80S41_9VIRU/748-1245IRLLRPIARNVHVPYT-----QAASGFEMWKNNSGRPLQETAPFGCKVQTNPLRASDCAYGNIPISLDIPNAAFMRISDA
POLS_MIDDV/754-1257LKLARPSAGTVHVPYT-----QTPSGFKYWLKEKGDALNHKAPFGCIIKTNPVRAENCAVGNIPVSLDIPDAAFTRIVDA
POLS_SLDV/788-1315IEVLQPTNDHVHVAYT-----YTTSGLLRWLQDAPKPLSVTAPHGCKISANPLLALDCGVGAVPMSINIPDAKFTRKLKD

PF00869

Q1P9U0_9FLAV/281-580---------------MRSLAGASVVDVQGTK...VYLQS.............GHVTCNVGLEKLKLKG------------
Q20II4_9FLAV/1-296---------------HTALTGATEIQMSSGN....LLFT.............GHLKCRLRMDKLQLKG------------
Q2TP99_9FLAV/281-576---------------HTALTGATEIQTSGTT....TIFA.............GHLKCRLKMDKLTLKG------------
Q9DS45_9FLAV/14-312---------------HTALAGAIPATVSSST...LTLQS.............GHLKCRAKLDKVKIKG------------
Q32ZD8_9FLAV/287-580---------------HSALGGAIPMKGTSSK...VDITA.............GHLKCRLKMDKLLIKG------------
A0EKU7_9FLAV/277-570---------------LKALSGANKGMKTSNK...YEISG.............GHVSCVVGLEGLKIRG------------
Q7TDX4_9FLAV/1-298---------------HQALAGAIVVEYSSS....VKLTS.............GHLKCRLKMDKLALKG------------
Q91B85_9FLAV/282-582---------------LKSLAGVPVANIEGSK...YHLQS.............GHVTCDVGLEKLKMKG------------
A1BY63_WNV/25-323---------------HQALAGAIPVEFSSNT...VKLTS.............GHLKCRVKMEKLQLKG------------
Q80L05_9FLAV/76-371---------------HSALAGATEVDSGDGN....HMFA.............GHLKCKVRMEKLRIKG------------
Q5DSL2_9FLAV/281-574---------------HTALTGATEIQNSGGT....SIFA.............GHLKCRLKMDKLELKG------------
Q8VBN2_9FLAV/1-301---------------LKSLAGVPLASVEGQK...YHLKS.............GHVTCDVGLEKLKLKG------------
A5YBK7_9FLAV/1-299---------------HTALAGAIPVEVSSTT...LTLNS.............GHLKCRLKLDKLKIKG------------
Q2VSS4_9FLAV/1-294---------------KTALTGAMRVTKDENDNNLYKLHG.............GHVSCRVKLSALTLKG------------
Q32ZD6_9FLAV/283-584---------------HSALAGATVAEMDSEK...AAIFS.............GHLKCRLKMDKLRLRG------------
Q9JAD5_9FLAV/268-560---------------FKSLVKAEEVTKTSNS...YHLTG.............GHVDCRVSTLNLRMKG------------
A0EKU5_9FLAV/278-571---------------MRALGEAEKGGKNGSK...FTVFG.............GHVSCFVGLEKLKVRG------------
Q32ZD5_9FLAV/287-585---------------QVALAGAMIAKFGSNV...ATINS.............GHLKCRLKLDKLKIKG------------
Q32ZE0_9FLAV/293-593---------------HSALAGAIMANRETSSPHALLLTA.............GHLKCRIKMDKMVIKG------------
Q9J9C2_9FLAV/272-565---------------FKALVKANEISKSNNK...YILDG.............GHLSCRIGVNGLKMVG------------
Q7T918_9FLAV/297-587---------------KASMVGATKISYSENK...YHIKG.............GHAVCQIQLQGLTMKG------------
Q8JJZ3_9FLAV/270-562---------------LKSLVKAEEIAKSGNS...YYLPG.............GHVDCRVSLVNLKLKG------------
A0EKU2_9FLAV/281-581---------------LHSLTGALMADVQGNK...YHLKS.............GHVTCEVGLEKLKLKG------------
O40971_LIV/1-301---------------LKALAGVPVAHIEGNK...YHLKS.............GHATCEVGLEKLKMKG------------
A8B3I1_9FLAV/176-474---------------HQALAGAIPVEFASST...LKLTS.............GHLKCRVKMEKLKLKG------------
A0EKU6_9FLAV/282-582---------------LKSLTGAGMVRLEGTK...VFMQS.............GHITCDVGLEKLKLKG------------
A0EKU1_9FLAV/277-570---------------LKILGDATKGRKTGNK...YELSG.............GHVSCSVGLEKLKLRG------------
Q8QVE1_9FLAV/285-590---------------MDVVLQGPVLKCSGNHCTKEQWSGNSETELPTITEDVGTLKCEIDYSGLKVRV------------
Q32ZD1_9FLAV/290-588---------------HAALAGAIPVKYASSK...LEMTS.............GHLKCRVKLQGLKLKG------------
Q32ZE1_9FLAV/291-588---------------HTALAGALEAEMDGAK...GRLFS.............GHLKCRLKMDKLRLKG------------
Q32ZD9_9FLAV/288-578---------------KLAMSGATRLQLSSGK...NVLKG.............GHAVCQVQTHGLTLKG------------
A0EKU3_9FLAV/273-567---------------MRSLAGANLAIKEGNS...YRIGG.............GHVSCRVGLEKLKVVG------------
Q80DN8_WNV/290-586---------------HQALAGAIPVDYKNSV...VKLSS.............GHLKCRVKMEKLKLKG------------
A1Y2M8_9FLAV/281-571---------------RTALSGAMVVEVSSNR...YTLKG.............GHVTCKAYMNDLTLKG------------
Q8QL64_9FLAV/273-565---------------LGALDKAEEIKKVGDN...YHLNG.............GHVSCKVSVAKLKLKG------------

PF01589

POLS_SFV/751-1253PTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHS-------------HSNVATLQEATAKVKT........AGKV
POLS_MAYAB/742-1242PVISELTCTVSTCTHSSDFGGIAVLSYKVEKSGRCDIHS-------------HSNVAVLQEVSIET..........EGRS
POLS_AURAV/748-1243PLPSLLKCTVTSCTYSTDYGGVLVLTYESDRAGQCAVHS-------------HSSTAVLRDPSVYVEQ........KGET
Q9PZX1_EEEV/740-1240PTVSDLECKITECTYASDFGGIATVAYKSSKAGNCPIHS-------------PSGVAVIKENDVTLAE........SGSF
Q80S25_9VIRU/747-1240PAVSHLQCIDVSCAHSAGFGGVAKLRFMADRTGKCAIHT-------------ASKIVAIQEATVDLPEIAVGAGGGTAEI
P89913_SINDV/749-1246PLVSTLKCEVGECVYSADFGGIATLQYSSDREGQCPVHS-------------HSSTATLQESTVHVLQ........KGGA
Q80S37_9VIRU/763-1264PVVSELQCTVASCTHSSDFGGVAAVTYKTDKAGKCAVHS-------------HSNVATLQEISMDVTE........AGKG
POLS_BFV/737-1238PSVSLKACEVQSCTYSSDFGGVASISYTSNKVGKCAIHS-------------HSNSATMKDSVQDVQE........SGAL
A4L7I3_CHIKV/744-1247PSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHS-------------MTNAVTIREAEIEVEG........NSQL
POLS_RRVT/752-1254PAVTDLSCQVVVCTHSSDFGGVATLSYKTDKPGKCAVHS-------------HSNVATLQEATVDVKE........DGKV
Q9IBP3_WEEV/738-1234PTILEVSCT.ADCIYSADFGGSLTLQYKADREGHCPVHS-------------HSTTAVLKEATTHVTA........TGSI
Q9YKC9_9VIRU/752-1250PTLSSAECSLNECTYSTDFGGIATVKYSASKSGKCAVHV-------------PSGTATLKESLVEVVE........QGSM
Q80S49_9VIRU/740-1237PVVTVASCSVTDCVYSADFGGVAGIDYVSDREGQCPVHS-------------HSSTAVLKESLVHVMQ........KGSI
Q80S39_9VIRU/746-1248PAITELTCTVASCTHSSDFGGVASLAFKTDKAGKCAVHS-------------HSNVATVQEADVDVQT........TGKV
Q80S41_9VIRU/748-1245PLISAATCTVSECIYSADYGGMASIQYTSDREGQCPVHS-------------HSSTASLQESTVHVVQ........SGTV
POLS_MIDDV/754-1257PSLTGLKCEVATCTHSSDFGGTLVVEYKTDKVGTCAVHS-------------ESNTAVMQETSLSVTM........DGRG
POLS_SLDV/788-1315PKPSALKCVVDSCEYGVDYGGAATITYEGHEAGKCGIHS-------------LTPGVPLRTSVVEVVA.......GANTV

PF00869

Q1P9U0_9FLAV/281-580--------------------------------------------------------------------------------
Q20II4_9FLAV/1-296--------------------------------------------------------------------------------
Q2TP99_9FLAV/281-576--------------------------------------------------------------------------------
Q9DS45_9FLAV/14-312--------------------------------------------------------------------------------
Q32ZD8_9FLAV/287-580--------------------------------------------------------------------------------
A0EKU7_9FLAV/277-570--------------------------------------------------------------------------------
Q7TDX4_9FLAV/1-298--------------------------------------------------------------------------------
Q91B85_9FLAV/282-582--------------------------------------------------------------------------------
A1BY63_WNV/25-323--------------------------------------------------------------------------------
Q80L05_9FLAV/76-371--------------------------------------------------------------------------------
Q5DSL2_9FLAV/281-574--------------------------------------------------------------------------------
Q8VBN2_9FLAV/1-301--------------------------------------------------------------------------------
A5YBK7_9FLAV/1-299--------------------------------------------------------------------------------
Q2VSS4_9FLAV/1-294--------------------------------------------------------------------------------
Q32ZD6_9FLAV/283-584--------------------------------------------------------------------------------
Q9JAD5_9FLAV/268-560--------------------------------------------------------------------------------
A0EKU5_9FLAV/278-571--------------------------------------------------------------------------------
Q32ZD5_9FLAV/287-585--------------------------------------------------------------------------------
Q32ZE0_9FLAV/293-593--------------------------------------------------------------------------------
Q9J9C2_9FLAV/272-565--------------------------------------------------------------------------------
Q7T918_9FLAV/297-587--------------------------------------------------------------------------------
Q8JJZ3_9FLAV/270-562--------------------------------------------------------------------------------
A0EKU2_9FLAV/281-581--------------------------------------------------------------------------------
O40971_LIV/1-301--------------------------------------------------------------------------------
A8B3I1_9FLAV/176-474--------------------------------------------------------------------------------
A0EKU6_9FLAV/282-582--------------------------------------------------------------------------------
A0EKU1_9FLAV/277-570--------------------------------------------------------------------------------
Q8QVE1_9FLAV/285-590--------------------------------------------------------------------------------
Q32ZD1_9FLAV/290-588--------------------------------------------------------------------------------
Q32ZE1_9FLAV/291-588--------------------------------------------------------------------------------
Q32ZD9_9FLAV/288-578--------------------------------------------------------------------------------
A0EKU3_9FLAV/273-567--------------------------------------------------------------------------------
Q80DN8_WNV/290-586--------------------------------------------------------------------------------
A1Y2M8_9FLAV/281-571--------------------------------------------------------------------------------
Q8QL64_9FLAV/273-565--------------------------------------------------------------------------------

PF01589

POLS_SFV/751-1253TLHFSTASASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQKISGGLGAFAIGAILVLVVVT
POLS_MAYAB/742-1242VIHFSTASASPSFVVSVCSSRATCTAKCEPPKDHVVTYPANHNGVTLPDLSSTAMTWAQHLAGGVGLLIALAVLILVIVT
POLS_AURAV/748-1243TLKFSTRSLQADFEVSMCGTRTTCHAQCQPPTEHVMNRPQKSTPDFSSAISKTSWNWITALMGGISSIAAIAAIVLVIAL
Q9PZX1_EEEV/740-1240TFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSAFIVLGLIATAVVA
Q80S25_9VIRU/747-1240TFHYSTALASPSFDVQLCSAHVTCDTKCEPPKDHIVPFAAQHMSNDMPNLSATAMNWVTGLGTSIGTFVFLFLGILLVVT
P89913_SINDV/749-1246TIHFSTASPQANFIVSLCGKKTTCNAECKPPADHIVNVPHKNDQEFQAAVSQTSWSWLFALFGGASSLLVIGVMIFACSA
Q80S37_9VIRU/763-1264ILHFSTATASPSFVVSICGARATCTASCTPPKDHIVPYPAKHNSIVFPDVTGTAMTWVQRLAGGFGTLTAVALIILILVT
POLS_BFV/737-1238SLFFATSSVEPNFVVQVCNARITCHGKCEPPKDHIVPYAAKHNDAEFPSISTTAWQWLAHTTSGPLTILVVAIIVVVVVS
A4L7I3_CHIKV/744-1247QISFSTALASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLGVQDISATAMSWVQKITGGVGLVVAVAALILIVVL
POLS_RRVT/752-1254TVHFSTASASPAFKVSVCDAKTTCTAACEPPKDHIVPYGASHNNQVFPDMSGTAMTWVQRLASGLGGLALIAVVVLVLVT
Q9IBP3_WEEV/738-1234TLHFSTSSPQANFIVSLCGKKTTCNAECKPPADHIIGEPHKVDQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSS
Q9YKC9_9VIRU/752-1250TLHFSTASIHPEFKLQICTKVLTCKGDCHPPKDHIVTHPQHHAQTFTAAVSKTAWTWLTSLLGGSAVIIIIGLVLATVVA
Q80S49_9VIRU/740-1237TLHFSTSSPQANFIVSLCGKKTTCHAQCKPPADHIIGEPHKVDQEFQAAVSKTSWSWMLAAIGGVSSLVIIGLIALTCSF
Q80S39_9VIRU/746-1248AIHFSTASASPSFTVSLCAARANCRASCEPPKDHIVPYAAKHNNVVFPDVSGTALGWVQKVAGGTGLILAVALVVLLIVT
Q80S41_9VIRU/748-1245TVHFSTASPQANFVISLCGKKTTCHAECKPPADHIVKTPHKNDQEFRSAVSTTSWSWLFALFGGASSLIFIGILIFMCSM
POLS_MIDDV/754-1257TLHFSTASASPSFVLKVCSSKTTCTAKCVPPKDHVVPFPANHNNVVFPDFSSTAVSWLTHTMGGATVVIAIGITIFLIVT
POLS_SLDV/788-1315KTTFSSPTPEVTLEVEICSAIVKCASECTPPKEHVVAARPRHGSDTGGYISGPAMRWAGRIVGNPSGPVSSSLAVTYCVV

PF00869

Q1P9U0_9FLAV/281-580------
Q20II4_9FLAV/1-296------
Q2TP99_9FLAV/281-576------
Q9DS45_9FLAV/14-312------
Q32ZD8_9FLAV/287-580------
A0EKU7_9FLAV/277-570------
Q7TDX4_9FLAV/1-298------
Q91B85_9FLAV/282-582------
A1BY63_WNV/25-323------
Q80L05_9FLAV/76-371------
Q5DSL2_9FLAV/281-574------
Q8VBN2_9FLAV/1-301------
A5YBK7_9FLAV/1-299------
Q2VSS4_9FLAV/1-294------
Q32ZD6_9FLAV/283-584------
Q9JAD5_9FLAV/268-560------
A0EKU5_9FLAV/278-571------
Q32ZD5_9FLAV/287-585------
Q32ZE0_9FLAV/293-593------
Q9J9C2_9FLAV/272-565------
Q7T918_9FLAV/297-587------
Q8JJZ3_9FLAV/270-562------
A0EKU2_9FLAV/281-581------
O40971_LIV/1-301------
A8B3I1_9FLAV/176-474------
A0EKU6_9FLAV/282-582------
A0EKU1_9FLAV/277-570------
Q8QVE1_9FLAV/285-590------
Q32ZD1_9FLAV/290-588------
Q32ZE1_9FLAV/291-588------
Q32ZD9_9FLAV/288-578------
A0EKU3_9FLAV/273-567------
Q80DN8_WNV/290-586------
A1Y2M8_9FLAV/281-571------
Q8QL64_9FLAV/273-565------

PF01589

POLS_SFV/751-1253CIGLRR
POLS_MAYAB/742-1242CVTLRR
POLS_AURAV/748-1243VFTAQH
Q9PZX1_EEEV/740-1240LVLFFH
Q80S25_9VIRU/747-1240IIRCFT
P89913_SINDV/749-1246LLTSTR
Q80S37_9VIRU/763-1264CVTLRR
POLS_BFV/737-1238IVVCAR
A4L7I3_CHIKV/744-1247CVSFSR
POLS_RRVT/752-1254CITMRR
Q9IBP3_WEEV/738-1234MLINTR
Q9YKC9_9VIRU/752-1250MYVLTN
Q80S49_9VIRU/740-1237MFISTR
Q80S39_9VIRU/746-1248CVGLRR
Q80S41_9VIRU/748-1245LMTNTR
POLS_MIDDV/754-1257CIAFSR
POLS_SLDV/788-1315KKCRSK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window