Sequence alignment for CL0545

PF14806

A8PX79_MALGO/823-952KDSSYVVLNEIHIDIMDYISPSY..VSETEFRSMWTGF-EWENK.VNVK--T.DIS.DVRQYLEHIMKATNMACLT...P
Q4P952_USTMA/843-973GDAKCVVLNDIHIDIMDYIAPAY..CNEAQFRAMWTEF-EWENK.VNVN--T.SIT.DLRDYLAHIMKSTNMSCLT...P
B0DLV5_LACBS/817-946MAEACVILNDIHIDIMDYIKPAY..CTEHQFRSMWTEF-EWENR.VNVN--Y.PLS.DPREYLKHVMKTTNMSCLT...P
Q5KDU2_CRYNJ/814-943DADVTIVMSDIHVDIMSFIKPNY..VNEAQFRSMWTEF-EWENK.VAVQ--T.SIS.DLRAYLDHLLKSTHMALLT...P
D8M9N0_BLAHO/804-931AEHAVVNLNEVYVSLMEYIKPAD..CDSKAFRTMWSAF-TWENK.ISVN--T.NLN.SLAGLIQRIADVTHMKIVSDFDP
Q1EQ38_ENTHI/773-901ALDANLILNELRIEYLDQMRPCD..VDIEVYQKKWMEY-EWENK.IPVD--T.ECT.DLKEYADLLCSIAKLQCIT...P
COPB2_ORYSJ/814-943MERSVVVLNDIHIDIMDYISPAT..CADVTFRNMWAEF-EWENK.VAVN--T.VIQ.NEKEFLDHIIKSTNMKCLT...P
E1ZGL3_CHLVA/809-938ADRSVVVLNDIHIDIMDYIVPAT..CPDVQFRSMWAEF-EWENK.VAIN--T.SID.QPTDFLQHIIASTNMRCLT...P
C1E4S7_MICSR/833-961SDRNVVVLNDVHIDIMDYISPAW..CEDNKFRSMWAEF-EWENK.VAVN--T.TIK.TVREFLDHIVESTNMRCLT...P
F0WYC5_9STRA/845-974AEKTYVNLNEIHLDIMDYIAPAT..CSDADFRSMWAEF-EWENK.VAVN--T.EIT.SVFGFLQHIMEKTNMRCMT...P
F0YGU1_AURAN/605-736AEKTYINLNNIHLDIMDYIRPAS..CSDQAFRHMWAEF-EWENK.VAIS--T.NIA.SLNDFLEHIVTSTNMCCLT...P
D7G7C5_ECTSI/823-954AEKTYINLNDIHMDIMDYIKPAS..CSEEAFRSMWAEF-EWENK.VAVN--T.SFT.DLNAFLKHLVAKTNTNCLT...P
D6W954_TRICA/812-944SDRNVVVLDDIHIDIMDYIVPAT..CSDSEFRQMWAEF-EWENK.VSVN--T.TLT.DLAEYLKHLIKSTNMKCLT...P
B3RRM9_TRIAD/820-953HDRNCVVLNEIHIDIMDYIMPAT..CTDTEFRQMWAEF-EWENKVVTVN--S.NIT.DIQEYLDHIIASTNMKCLT...S
E4YEK8_OIKDI/819-948SDRNCVVLNDIKIDIMDYIQPAF..CSDQEFREMWSAF-EWENK.VTVH--T.NIG.DLREYLLHLVGATNMKCLT...P
A8XW26_CAEBR/814-947SDRNCVYLQDIKIDIMDYIVPGN..VTDTEFRQMWSDF-EWENK.VNVM--T.PIR.DLREFLNHLSTSTNMKVLT...G
F1KUI3_ASCSU/821-954SDRNCVYLQDIHIDIMDYIVPGS..CTDTEFRQMWAEF-EWENK.VNVN--T.PIT.SLRAFLTHLSSVTNMKLLT...T
E5SGW1_TRISP/821-953GDRNCIYLNDIHVDILDYIVPMS..CSDEEFRQMWSEF-EWENK.VTVN--T.TIT.DLKEYLDFLVKSTNMRCLT...P
D3BC39_POLPA/772-903SDKNCVILNEINIDIIDYIQPITHQYTDVLFRNHWLEF-EWENK.IPVY--T.NIT.DLVAYVQHISKITNMGILT...P
E9C8S6_CAPO3/652-781ADRNCVVLNDIHVDIMDYIVPTS..CSDEEFRSMWATF-DWENS.LPVL--T.GLT.SLTDYLHYFEKITNMKTLT...T
A9V7K9_MONBE/809-938SDRNCVILNDIHIDILDYIKAAQ..CTDVEFRNMWAEF-EWENK.VAVR--T.TIP.TLRGYLEHVQKTTNMRCLT...P
F2TX28_SALS5/808-937SDRNCVILNDIHIDIMDYITPAM..CSEVEFRAMWAEF-EWENK.VSVR--T.SIT.DLNAYLNHIKQTTNMQCLT...P
D2VRU3_NAEGR/870-1001GESFCIILNDIHINIMDYIFPAI..CNDIQFRAMWFEF-EWENK.ITIK--SFTTDVSLRDYLTLIKDVTKTNCLT...P
D4B2Z1_ARTBC/816-946TETHVVILNDIKADIMDYIQPAH..CTETQFRTMWTEF-EWENK.VNIH--S.KAK.SLRAFLQQLMDRTNMSCLT...P
B6K5M6_SCHJY/799-929LESRVVILNGISINIMDYIKPVY..IPESEFRSMWTEV-EWENK.VDIV--R.NEDITVHEFLHDLMKKTNMKCLT...P
Q6CT54_KLULA/826-957QDSRYVILNDVHIDTMDYVKPAI..CDDNSFRKMWNAF-EWENK.LRIK--S.KLP.SLRGYLEKLVEVTHMKVLT...P
Q75DY5_ASHGO/826-957EDARYVILNDVHVATMDYIKPAV..CDEASFRKMWNAF-EWENK.MVVK--S.KLP.TLHDYLNKLIEVTHMNVLT...P
C5DI95_LACTC/828-959EDARYVIMNDIHVDIMDYIKPAK..TDDATFRKMWNAF-EWENK.ITVK--S.KLP.TLHAYLDELIKGMRMGILT...P
E7LSY7_YEASV/828-959EDARXVILNDVHVDIMDYIKPAT..ADDEHFRTMWNAF-EWENK.ISVK--S.QLP.TLHAYLRELVKGTNMGILT...P
Q6BKT9_DEBHA/805-934DDSTIVILNDVHVDIMDYIKPAT..CTESTFRKMWNEF-EWENK.ITIK--A.QMD.SLKDYLEEMMKGTNMNCLT...P

PF14807

A7T9X2_NEMVE/76-178-------------------RPLV--LTTEEFAVKWGQS.AFERR-QTI...TCSVS-SSGEFLRRTESDLRLHPVS---S
E7FEH2_DANRE/1015-1119-------------------RPLV--VTTDEYGKLWLSL.SHDVK-QNLKLLTDAGD-PLQTTLNALKDTLQLHIVD---I
E1BR26_CHICK/1039-1142-------------------RPMK--MTTEDFGKLWLSL.SNDVK-QNIK.MPSSQD-SISAALSVLHQKLKLHIVD---I
A9V3X8_MONBE/1245-1348-------------------RPLT--ISTDRFGQLWQAT.SSQRA-LKL...QSRQV-SSVAALQQVCEASHFHCVQ---V
Q68D31_HUMAN/957-1060-------------------RPLK--ISSDDFGKLWLSF.ANDVK-QNVK.MSESQA-ALPSALKTLQQKLRLHIIE---I
D3BA10_POLPA/1108-1220-------------------RPLD--IGLNQFEQTWSSY.SQERE-IIVD..SSLQQ-KSSQLLTCFIKGLHLHTIQ---P
E9C3Y1_CAPO3/1207-1311-------------------RPLR--ITTAQFGPKWSGM.RQERK-QRVL..QCAVR-TQPELMERFRTQLNLHSVE---I
F2U7H5_SALS5/1177-1282-------------------RPLS--LSTEEFGAMWQSQCTAERA-QMIT..SSPVT-TVDDLSSSALETLHLSTVA---I
A2EQ12_TRIVA/904-1007-------------------APQQ--STTAEFGAAWKSG.GSEIV-YTIP..RSEGL-TIDEVSRLMNLAIGVKTVQ---R
A2DQQ6_TRIVA/901-1004-------------------VPQT--ATTNEFGAAWKSG.GSELV-LSLQ..KKDGM-TLDDISAALNNLAHVKTVQ---R
Q4S1E4_TETNG/961-1062-------------------RPLA--VSTEEYGKMWLDF.SHDTK-QNLKVM...GD-GLADTLQVLTNKLQLHVVE---I
D3ZX21_RAT/1018-1121-------------------RPLK--ISTEDFGKLWLSF.ANDVK-QNIK.ISEPRV-ALASVLTELQQKLRLCVVD---V

PF14806

A8PX79_MALGO/823-952EASLAG.ECGFLSANLSATSLFGEDALANVSIER....LDNGTIQGHVRIRSK--TQGIALSLGDKLS
Q4P952_USTMA/843-973EASLAG.ECGFLSANMYARSLFGEDALANLSIELL...PDGKTIQGHVRIRSK--TQGIALSLGDKIT
B0DLV5_LACBS/817-946EGATSG.ECDFLSANMYARSLFGEDALANLSVER....TEAGTITGHVRIRSK--TQGIALSLGDRIT
Q5KDU2_CRYNJ/814-943EAALSG.DCDFLSANLAAKSLFGEDALANASIER....TEDGHITGHVRIRSK--TQGIALSLGDKIT
D8M9N0_BLAHO/804-931ET.....DADFMAANLYARSLFGEDILLNVSVEK.....TPMGVSGYYRIRSK--TQGVAISLGDVIK
Q1EQ38_ENTHI/773-901A.IMFCDSIGFLSANFYAKNLFDEDALINLSAEK.....IGNKISGWVRIRSK--TQSLAINLGDRIV
COPB2_ORYSJ/814-943PSALDG.ECGFLAANLYAKSVFGEDALVNISIEK...QF.DGKLSGYIRIRSK--TQGIALSLGDKIT
E1ZGL3_CHLVA/809-938PSALDG.DCGFLAANLYARSVFGEDALVNVSVEK...LP.DGRLGGYIRIRSK--TQGIALSLGDKLI
C1E4S7_MICSR/833-961PSALEG.DCGYLAANLYAKSVFGEDALVNVSVEE...Q..DGVVSGFIRIRSK--TQGIALSLGDKIT
F0WYC5_9STRA/845-974TATLGA.DTNFLAANLYAKSIFGECALVNLSVEK..HD..KGRITGYIRIRSK--TQGIALSLGDRVT
F0YGU1_AURAN/605-736SSSLGG.TSSFLAANLYAKSIFGEDALVNVSVEK..KDDADGKLSGYIRIRSK--TQGIALSLGDRIT
D7G7C5_ECTSI/823-954LSSLDG.SSSFLAANLYAMSVFGEDALVNVSVEK..KSDADGKLSGHVRIRSK--TQGIALSLGDRIT
D6W954_TRICA/812-944EKALSG.QCGFMAANMYAKSIFGEDALANLSIEKPFN.KPDAPVTGHIRIRAK--SQGMALSLGDKIN
B3RRM9_TRIAD/820-953DTALKG.DCGFLAANLYAKSIFGEDALANVSIERTAD.QSETPVTGHIRIRAK--SQGMALSLGDKIN
E4YEK8_OIKDI/819-948EQTMSG.NCEFLAANLYAKSMFGESALANLSIEV....GKNGFVLGHIRIRAK--SQGMAISLGDKIN
A8XW26_CAEBR/814-947DAAIEG.ECGFLAANLCAHSIFGEDALANVSVEKALPMDDASPIVGHIRIRAK--SQGMCLTLGDKLS
F1KUI3_ASCSU/821-954EEALQG.ECGFLAANFCAHSIFGEDALANVSIEKTNPLDPNSSIIGHIRIRAK--SQGMALSLGDKIN
E5SGW1_TRISP/821-953EPALSG.DSGFLAANLYARSIFGEDALANLSIEKSSS.NSEAVVIGHIRIRAK--SQGMALSLGDRMN
D3BC39_POLPA/772-903DIHLSN.ETGILSANLCAKSVFGEDALANICIEK....QEDGKIVGYIRIRSK--VQGIAVSLGARIT
E9C8S6_CAPO3/652-781DAALMS.DSGILVANLAAKSLFGEDALANLSIEL....TGEGRIVGRVRIRSR--TQGIAVALGKKFT
A9V7K9_MONBE/809-938ASALAG.ECDFLAANLYARSVFGEDALANLSIEK....LPDGTVTGHIRIRSK--TQGIALSLGDKIT
F2TX28_SALS5/808-937DSALTG.DCNFLAANLYAKSVFGEDALANLSIEK....GPDGQITGHIRIRSK--TQGIALSLGDKIT
D2VRU3_NAEGR/870-1001ESALDG.DCEFLSANLYAKSSFGEDALANVSLEK....LPEGNIEGVVRIRSK--TQGIALSLGNIIA
D4B2Z1_ARTBC/816-946EASLEG.DCQFLSANLYARSVFGEDALANLSIEKE...GDDGPITGFMRIRSR--SQGLALSLGSLKG
B6K5M6_SCHJY/799-929ESSLRG.DCQFLSANLYARSIFGEDALMSLSIEK....TTDGKILGHVRIRSK--TQGVALSLGSVVA
Q6CT54_KLULA/826-957EEALGDNDSRFLSCNLYSRSTFGEDALANLCIEKD...PITQEIVGEIRIRSK--TQGLALTNGDNIT
Q75DY5_ASHGO/826-957EESFADPECRFLSCNLYSKSTFGEDALANLCIERD...PTSGSIIGEVRIRSK--TQGLALTHGDSIA
C5DI95_LACTC/828-959EEALGEEGCRFLSCNLYSKSTFGEDALANLCIEKD...PTSHEITGHVRIRSK--GQGLALSLGDRVA
E7LSY7_YEASV/828-959SESLGEDDCRFLSCNLYAKSSFGEDALANLCIEKD...SKTNEVIGYVRIRSK--GQGLALSLGDRVA
Q6BKT9_DEBHA/805-934GAIIGE.ECQFLSANLYSRSSFGEDALANLCIEKQ...S.DGPIIGHVRIRSK--GQGLALSLGDRVA

PF14807

A7T9X2_NEMVE/76-178TGD...-.NVIASGTVLNASK......CLLHAAL----SSSGSLEIWIKTNSQLLSEVVMKQCIAIMQ
E7FEH2_DANRE/1015-1119IGS...-.EGIVACRLLSGAP......CLLHCRV----NGS.ALAMWLRSPLPALPDCILYHCQRALA
E1BR26_CHICK/1039-1142IGN...-.EGILACQLLPSVP......CLLHCRT----HSG.MLALWFRSPCSALPDGLLYQCQKVME
A9V3X8_MONBE/1245-1348IGT...-.EVIFAAQVLNHEQQP....CLLHTKL----NAP.VIEVQVHAHATPYAESVLKLLEDNLS
Q68D31_HUMAN/957-1060IGN...-.EGLLACQLLPSIP......CLLHCRV----HAD.VLALWFRSSCSTLPDYLLYQCQKVME
D3BA10_POLPA/1108-1220LDSDNH-TEFFGATQLKVNSNIAAGGITLFKLGY----NGG.RLTISLKTNDKNFSDVISRHCYKIHN
E9C3Y1_CAPO3/1207-1311IGV...-.EGITAASVLQTQSV.....CLVHTKL----VEPGTIDVYIRSTDMALTDAVMAQCAPALK
F2U7H5_SALS5/1177-1282IGA...-.EVIMAGQLLNNSDRV....CLIHWRV----DAP.TLHAAVRTKSMPFTEAVLQVVVSSFR
A2EQ12_TRIVA/904-1007IGQ...-.EEIFMGILVSTPFK.....ILIHVKF----GNQ.KVDFKVLTKAQPLTASIVNDLKTVFA
A2DQQ6_TRIVA/901-1004IGQ...-.EEIFMGLLVSTPFK.....VLIHVKF----GAQ.KVDVKILSKAQPLTASVLNDLKNIFA
Q4S1E4_TETNG/961-1062IGM...-.EGIVACQLLQNQP......CLLHCRL----HAG.ALAVWLRSPVPELPDCLLYHCQRALN
D3ZX21_RAT/1018-1121IGS...-.EGLLACKLLPSTP......CILHCRV----HAD.VVALWFRSSSSVLSDCLSCHCQKVMQ

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window