# STOCKHOLM 1.0 #=GF ID DUF3924 #=GF AC PF13062.1 #=GF DE Protein of unknown function (DUF3924) #=GF AU Mistry J, Aldam G #=GF SE Pfam-B_1601 (release 24.0) #=GF GA 20.90 20.90; #=GF TC 22.30 125.80; #=GF NC 19.60 19.20; #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq #=GF TP Domain #=GF DR INTERPRO; IPR025038; #=GF CC This family of proteins is functionally uncharacterised. This #=GF CC family of proteins is found in bacteria. Proteins in this family #=GF CC are approximately 60 amino acids in length. #=GF SQ 2 #=GS C2USY1_BACCE/1-62 AC C2USY1.1 #=GS A7GMZ8_BACCN/1-58 AC A7GMZ8.1 C2USY1_BACCE/1-62 MNTLTIELPQETAEKLDLLKQAYEKKTGASISESTLVQTLISKEFIQAITPFDLQQFINGKE A7GMZ8_BACCN/1-58 MSTLTIELPKDIAEKLDLLKQVYQKKTGATISDS....TLISKEFVQKITPFDLQQYVIEKE #=GC seq_cons MsTLTIELPp-hAEKLDLLKQsYpKKTGAoIS-S....TLISKEFlQtITPFDLQQal.tKE //